KEGG   Rattus norvegicus (rat): 305571
Entry
305571            CDS       T01003                                 

Gene name
B3gnt2
Definition
(RefSeq) N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
  KO
K00741  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.149]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    305571 (B3gnt2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    305571 (B3gnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    305571 (B3gnt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     305571 (B3gnt2)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   305571 (B3gnt2)
SSDB
Motif
Pfam: Galactosyl_T DUF604 Fringe
Other DBs
NCBI-GeneID: 305571
NCBI-ProteinID: NP_001100710
RGD: 1310077
Ensembl: ENSRNOG00000009267
UniProt: D3ZEF9
Position
14
AA seq 397 aa
MSVGRRRVRLLGILMTANVFIYLIVEVSKSSSQDKNGKGGVIIPKEKFWKLSSLPRAYWN
REQEKLNRWYNPILNRVANQTGDLFTSPNTSHLNYCEPDSTVMTAVTDFNNLPDRFKDFL
LYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVF
LLGKTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEF
VFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVY
PPYAGGGGFLYSGPLALRLYNVTDRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEE
KNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtgtggggcgtcgaagagtaaggttgctgggcatcctgatgacagcaaatgtcttc
atctatttgattgtggaagtctccaaaagcagtagccaagacaagaatggaaagggggga
gtgataataccgaaggagaagttctggaagctgtccagccttccccgcgcatactggaat
agggagcaggagaagctcaacaggtggtacaatcccatcttgaacagggtggccaatcag
acgggggatctgttcacatctccaaacacaagtcacctgaactattgtgaaccggactcg
acagtcatgacagctgtgacagattttaataatctgccggacagatttaaagactttctc
ttgtatttgagatgccgaaattactcgctgctcatagatcaaccgaagaagtgtgcaaag
aagcccttcctactgttggcgataaagtccctcattccacatttcgccagaaggcaagca
attcgggaatcttggggccgagagaccaatgtagggaaccagacagtggtaagggtcttc
ctgttgggcaagacacccccagaggacaaccaccctgacctctcggacatgctgaagttc
gagagtgagaagcaccaggacatcctcatgtggaactatagagacacattcttcaacctg
tctctcaaggaagtactgtttctcaggtgggtgagcacttcctgtccagacgccgagttt
gtcttcaagggtgatgatgacgtgttcgtgaacacccatcacatcctgaattacttgaat
agcttatccaagagcaaagccaaagacttgttcataggtgacgtgatccacaatgctggg
ccccatcgggataagaaactgaagtactacatcccagaagtcttctacactggggtctac
ccaccgtatgcagggggcggtgggtttctgtactctggcccgctggccttgaggctttac
aatgtaactgaccgggtccacctctaccccatcgatgacgtttatactggaatgtgcctt
cagaaactgggccttgttccggagaaacacaaaggcttcaggacatttgatattgaagag
aaaaataagaaaaatatttgttcatatatagatctaatgttagtacacagcaggaaacct
caagagatgattgacatctggtctcagttgcaaagtcctaatttaaaatgctag

DBGET integrated database retrieval system