KEGG   Rattus norvegicus (rat): 305600
Entry
305600            CDS       T01003                                 

Gene name
Fancl
Definition
(RefSeq) Fanconi anemia, complementation group L
  KO
K10606  E3 ubiquitin-protein ligase FANCL [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    305600 (Fancl)
  09124 Replication and repair
   03460 Fanconi anemia pathway
    305600 (Fancl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    305600 (Fancl)
   03400 DNA repair and recombination proteins [BR:rno03400]
    305600 (Fancl)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     305600 (Fancl)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    305600 (Fancl)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     305600 (Fancl)
SSDB
Motif
Pfam: FANCL_d3 FANCL_C FANCL_d1 FANCL_d2 zf-RING_2 zf-HC5HC2H zf-HC5HC2H_2 zf-ANAPC11 zf-rbx1 RINGv
Other DBs
NCBI-GeneID: 305600
NCBI-ProteinID: NP_001178613
RGD: 1311427
Ensembl: ENSRNOG00000027249
UniProt: D3ZAU3
Position
14q22
AA seq 375 aa
MADTEANLLRHFPLLLPQNREKTVYEGFISAQGRDFHLRIVLPKDQQLKKARLLCSWQLK
NILNEYHQVVQQRMKHSPDLMSFMMELKIILEAALKNKQELYVQPPSCSFCKDLLTEIGA
IGWDKLACVDTSFTTIKLKADDASGRKHLITVKLKAKYPVEPPDCLVDFPIPFSVSWTPQ
SSLVNVYSQFSAALETLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGHDVSINIEV
DPRHPTMLPEFCFLGADHVTKPLGMRLSGNIHLWDPENSLLQNLKDVLEIDFPARTVLEK
SDFSMDCGICYARHLNGAIPDQVCNNPQCGQLFHQMCLYEWLRGLSSSRQSFNVFFGECP
YCSKPITLKMSGRKP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcggacacggaagcaaacctgttgcgccatttcccgctgctgcttcctcagaatcgg
gagaaaactgtgtatgagggcttcatttcggctcagggacgggatttccacctcaggata
gtgctgcccaaagaccagcagctgaagaaggcgagattactgtgtagctggcagctgaaa
aatatacttaatgaatatcatcaagtagtccaacagagaatgaagcactctccggatcta
atgagcttcatgatggagttgaagatcattttggaagcagctttaaagaataaacaagag
ttatatgtgcaaccaccttcttgcagtttctgcaaagaccttcttactgagataggagcc
attggctgggataaactcgcatgtgtggatacgtccttcaccaccatcaagttaaaagca
gatgacgcttccggtagaaagcacctaatcactgtcaagttgaaggcaaagtaccctgta
gagccaccagattgccttgtggactttcctattccattttctgtttcctggacaccacag
agctccttggtaaatgtttacagtcagttctcggcagcgttagagacactgaaggcattc
tgggatgttatggatgaaattgatgagaagacttgggtgctggaaccggagaaacctccc
cgaagcgcgacagcacgcaggattgcattagggcatgatgtctccataaacatagaggta
gaccccaggcaccctaccatgcttcctgagttttgctttcttggagctgaccatgtgaca
aagcccctaggaatgaggctgagtgggaacattcatttatgggatccagaaaatagtctg
ttacagaatttgaaagatgttttagaaattgatttcccagctcgtactgtcctggaaaaa
tctgacttcagcatggactgtggtatctgttatgcccgtcacctgaatggtgccatccct
gatcaagtgtgtaacaatccccagtgtggacagcttttccatcaaatgtgcttgtatgag
tggctgagagggctgagcagcagtcgacagagtttcaacgtcttctttggtgaatgtccc
tactgtagtaagccaattaccttgaaaatgtctgggagaaaaccctga

DBGET integrated database retrieval system