KEGG   Rattus norvegicus (rat): 305604Help
Entry
305604            CDS       T01003                                 

Gene name
Efemp1, T16
Definition
(RefSeq) EGF-containing fibulin-like extracellular matrix protein 1
  KO
K18262  EGF-containing fibulin-like extracellular matrix protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    305604 (Efemp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   305604 (Efemp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF FXa_inhibition EGF EGF_3 hEGF EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 305604
NCBI-ProteinID: NP_001012039
RGD: 1308528
Ensembl: ENSRNOG00000003553
UniProt: Q6AXN2
Position
14q22
AA seq 493 aa AA seqDB search
MLQTVFLTMLTLALVKSQVTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEASSGAATGTIAARSMATSGVIPGGGFIA
SATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTSG
THNCRLDQVCINLRGSFTCHCLPGYQKRGEQCVDIDECSVPPYCHQGCVNTPGSFYCQCN
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PQNPCQDPYVLTSENRCVCPVSNTMCRDVPQSIVYKYMNIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLTGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaacagttttcctaactatgctgactctggctctggtcaagtcacaggtcacg
gaggaaaccattacatacacgcaatgcaccgatggatatgaatgggaccctgtaagacag
cagtgcaaagatattgatgagtgtgacattgtaccagatgcttgcaaaggtggaatgaaa
tgtgtcaaccactatggaggatacctctgccttcctaaaacagcccaaattattgtcaat
aacgaacagcctcagcaagaaacaccagctgccgaagcatcgtcgggtgctgccactggg
accatagctgccaggagcatggctaccagtggtgtgatccctgggggtggcttcatagcc
agtgctactgcagttgctggtcctgaagttcagacaggccgaaataacttcgtcattcgg
aggaacccggctgaccctcagcgcatcccttccaacccttcccaccggatccagtgtgca
gcaggctatgaacagagtgagcataatgtgtgccaagacattgatgagtgcacctcaggg
acccacaattgtagattggaccaagtgtgcatcaatttacgtggttccttcacatgccac
tgtcttcctgggtatcagaagcgaggcgaacagtgtgtggatatagatgagtgctcagtg
cccccatactgccaccaaggatgtgtgaacaccccgggttccttttactgtcagtgcaat
cccgggtttcagctggcagcaaacaactacacttgtgtggatataaatgaatgtgatgcc
agcaaccagtgcgctcagcaatgctacaacattcttggctcattcatctgtcagtgcaac
caaggatatgaactgagcagtgacagactcaactgtgaagacatcgatgaatgcagaacc
tcaagctacctgtgccagtatcaatgtgtcaatgaacctgggaagttctcatgtatgtgt
cctcagggttaccaagtggtgcgaagcagaacctgtcaggatataaatgaatgtgagacc
accaatgaatgccgagaagatgaaatgtgctggaattaccatggtggcttccgctgttac
ccacaaaacccatgtcaagatccctatgttctaacgtcagaaaaccgatgcgtttgcccg
gtctcaaacaccatgtgccgagacgtgccccagtctatagtctacaaatacatgaacatc
cgatctgacaggtccgtgccatcagacatcttccagatacaggcaacaacgatttatgca
aacaccattaatacttttcggattaaatctggaaatgaaaatggagagttctacctacga
caaacaagccctgtgagtgcaatgctggtgcttgtgaagtcgctaacaggaccaagagaa
cacatcgtggacctggagatgctgacagtcagtagtatagggaccttccgcacaagctct
gtgttaagattgacaataatagtggggccgttttcattttaa

DBGET integrated database retrieval system