KEGG   Rattus norvegicus (rat): 305614Help
Entry
305614            CDS       T01003                                 

Gene name
Sptbn1, Spnb1, Spnb2
Definition
(RefSeq) spectrin, beta, non-erythrocytic 1
  KO
K06115  spectrin beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    305614 (Sptbn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     305614 (Sptbn1)
  Intermediate filaments
   Intermediate filament-binding proteins
    305614 (Sptbn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH PH_9 PH CAMSAP_CH PH_11
Motif
Other DBs
NCBI-GeneID: 305614
NCBI-ProteinID: NP_001013148
RGD: 727922
Ensembl: ENSRNOG00000005434
UniProt: Q6XD99
Position
14q22
AA seq 2358 aa AA seqDB search
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAESYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIS
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEISNYRPTIDTLHEQAGALPQAHAESPDVKGRLAGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTTSAQNKVLDGASVFLLMYSCPPRCWRI
RWKRGRAQMRVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERM
PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQ
RLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQ
SAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKD
LAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFAR
DTGNIGQERVDTVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASY
ELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQE
DAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLML
WMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKALLARKHYAS
EEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREI
GQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEP
SAKVSEEAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETSEMVNGAAEQRTSSKESSP
VPSPTSDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRSWHNVY
CVINNQEMGFYKDAKSAASGVPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYL
FQAKDDDEMNTWIQAITSAISSDKHDTSASTQSTPASSRAQTLPTSVVTITSESSPGKRE
KDKEKDKEKRFSLFGKKK
NT seq 7077 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacggtggccacagactatgacaacattgagatccagcagcagtacagcgat
gtgaacaaccgctgggacgtggatgactgggacaatgagaacagctctgcacggctcttt
gagcgctcccgcatcaaggccctggcagatgagcgtgaagctgtacagaagaagaccttc
accaagtgggtcaactcccaccttgcccgagtgtcctgccgaatcacagacctgtacact
gaccttcgagatggacggatgctcatcaaactactggaggtcctctctggagagaggctg
cctaaacccactaagggacggatgcgcatccactgtctggagaatgtcgacaaggctctt
cagttcctgaaggagcagagagtccatctcgagaacatgggctcccatgatattgtggat
ggaaaccaccggctgaccctcggcctcatctggaccattatcctgcgcttccagatccag
gatatcagtgtggagactgaagataacaaagagaaaaagtctgctaaggatgcattgctg
ctgtggtgccagatgaagacagctgggtaccctaatgtcaacattcacaatttcaccact
agctggagggatggcatggccttcaatgcactgatacacaaacaccggcctgacctgata
gattttgataaactgaagaaatcgaatgcacactacaatctgcagaatgcatttaacctg
gcagagcagcaccttggccttactaaactgttagaccctgaagatatcagcgtggaccac
cctgatgagaagtccatcatcacgtatgtggtcacttactaccactacttctccaagatg
aaggccttggctgtcgaaggaaagcgcattgggaaggtgcttgataatgctatagaaaca
gagaaaatgattgagaagtatgagtcgcttgcttctgaccttctggagtggattgaacaa
accatcatcattctaaacaaccgcaaatttgctaattcactggttggggtccagcagcag
cttcaggcattcaacacgtaccgcacagtggagaaaccacctaagtttactgagaagggg
aatttggaggtgctgcttttcacaattcagagcaagatgagagctaataatcagaaggtc
tacatgccccgagaagggaagctcatctctgatatcaacaaggcctgggaaagactggaa
aaagcagaacatgagagagaactggctctgcggaatgagctcatacggcaggaaaaactg
gaacaacttgcccgcagattcgatcgcaaggcagctatgagagagacatggctgagcgaa
aaccagcgtcttgtctctcaggacaactttggatttgaccttcctgcagttgaggccgcc
accaaaaaacatgaggccatcgagactgacattgcggcgtatgaagagcgagtgcaggct
gtggtggctgtggccagggagcttgaagcagagagctatcatgacatcaagcgcatcaca
gcgaggaaggacaatgtcatccgcctctgggagtacttgctggaactgctcagggccagg
aggcagcgtcttgagatgaacctgggactgcaaaagatattccaggaaatgctttatatt
atggactggatggatgaaatgaaggtgctattgctgtctcaggactatggcaaacacttg
ctcggtgttgaagacttgttacagaagcatgccctggttgaagcagacattgcaatccaa
gcagaacgtgtgagaggtgtgaatgcctctgcccagaagttcgcaacagatggggaaggc
tacaagccatgcgacccccaggtaatccgagaccgtgtggcccacatggaattctgctat
caagaactctgtcagctggcagctgagcgtagggctcgcctggaagagtctcgtcgcctc
tggaagttcttctgggagatggcggaggaggaaggctggatacgggagaaggagaagatc
ctgtcctctgatgactatgggaaagacctgactagtgtcatgcgcctgctgagcaagcac
agggcttttgaggatgagatgagtggccgtagtggccattttgagcaggccattaaagaa
ggtgaagacatgattgcagaggaacactttggatcagaaaagatccgtgagagaatcagt
tacattcgagagcagtgggccaacctggagcagctctcagccattaggaagaagcgccta
gaggaggcctcattgctgcaccagttccaggctgatgctgatgacatcgacgcttggatg
ttagatatactcaagattgtgtccagcaacgatgtgggccatgatgagtattccacacag
tctctggtcaagaagcataaagatgtggcagaagagatctccaactacagacccactatt
gacacactgcatgagcaagccggtgctcttcctcaagcacacgcagagtctccagatgtg
aagggccggctggcaggaattgaggagcgttacaaggaggtggcagagttaacacggcta
aggaagcaggcactgcaggacaccctggctctgtacaagatgttcagtgaggctgatgcc
tgtgagctctggatcgacgagaaggagcagtggctcaacaacatgcagatcccagagaag
ctggaggacctggaagtcatccagcacagatttgagagcctagaaccagaaatgaacaac
caggcttcccgggttgctgtggtgaaccagattgcacggcagctgatgcacagtggccat
cccagcgaaaaggaaatcagagctcagcaggacaaactcaacacgaggtggagtcagttc
agagaactggtggacaggaagaaggatgctcttctgtccgccctgagcatccagaactac
cacctcgagtgcaatgaaaccaaatcctggatccgggagaagaccaaggtcatcgagtct
acccaagaccttggcaatgacctggcaggtgtcatggccctgcagcgcaagctgaccggc
atggaacgagacttggtagccatcgaggcgaagctgagtgacctgcagaaggaagccgag
aagcttgagtccgagcaccctgaccaggctcaagccatcctgtctcgactggctgagatc
agtgacgtgtgggaggagatgaagacaaccctgaagaaccgagaagcctcgctgggagag
gccagcaagctgcagcagttcctgcgggacttggatgacttccagtcttggctctccagg
acccagactgctattgcctcagaggacatgcccaataccctgactgaggcagagaagctt
ctcacacagcatgagaacatcaaaaacgagattgacaattacgaggaagactaccagaag
atgcgggacatgggcgagatggtcacgcagggacagactgatgcccagtacatgtttctg
cggcagcggttgcaggccttggacacaggctggaacgagctccacaaaatgtgggagaac
aggcaaaatctcctctcccagtcccatgcctaccagcagttccttagggacacgaaacag
gctgaagctttccttaataaccaggagtatgttttggctcatactgaaatgcccaccacc
ctggaaggagctgaagcagccattaagaagcaggaggacttcatgaccaccatggatgcc
aatgaggagaagatcaatgctgttgtggagactggccggaggctggtgagcgatgggaat
atcaactccgaccgcatccaggagaaggtggactctattgatgacaggcacagaaagaat
cgagaagcagccagtgaacttttgatgaggttaaaggacaaccgtgatctacagaagttc
ctgcaagattgtcaagagctgtccctctggatcaatgaaaagatgcttacagctcaggac
atgtcttatgatgaagccagaaacctgcacagtaaatggttaaagcatcaagcatttatg
gcagaacttgcatccaacaaagaatggcttgacaaaattgagaaggaaggaatgcagctt
atttcagaaaagccagaaacagaggctgtggtgaaggagaaactcactggtttacataaa
atgtgggaagtccttgaatccacaacccagaccaaggcccagaggctcttcgatgcgaac
aaggctgagctcttcacgcagagctgtgcagacctcgacaaatggctgcatggcctggag
agccagattcaatctgacgactatggcaaagacctcaccactagcgcccaaaacaaagtt
ctagatggagcctctgtgttccttctgatgtactcttgcccccccagatgctggagaatc
agatggaagaggggaagagcacagatgagggtggacagcaaacgcctcactgtgcagacc
aagttcatggagcttctggagcccttgaatgaaaggaagcataatctgctggcttccaag
gagatccaccagttcaacagggatgtagaggacgagattctgtgggttggcgagaggatg
cctttggcaacttccacagatcatggccacaaccttcaaactgtgcagctgttaataaag
aaaaaccagaccctccagaaagaaatccagggacaccagcctcgtattgatgacatcttt
gagaggagccaaaacatcatcacagatagcagcagcctcaatgccgaggctatcagacag
aggctcgccgatctgaagcagctgtgggggctcctcattgaggaaactgagaaacgccat
agacggctcgaggaggcacacaaggcccagcaatactactttgatgcagctgaagcagag
gcatggatgagtgaacaggaactgtacatgatgtctgaggaaaaggccaaggatgagcag
agtgctgtctccatgttgaaaaagcaccagattttggaacaggctgttgaggactatgca
gagacagtgcaccagctctccaagaccagccgggcactggtggctgacagccatcccgaa
agtgagcgtattagcatgcggcagtcaaaggtcgacaagctgtatgctggcctgaaggac
cttgctgaggagaggagagggaaacttgatgagaggcacaggctattccagctcaacagg
gaggtagatgacctggaacagtggatcgccgagagggaagtggttgcaggctcccatgag
ttgggacaggactatgagcatgtcacgatgttacaagaacggttccgagaatttgctcga
gacacaggaaacattgggcaggagcgtgtagatacagttaaccacatggcagatgacctc
atcaattctggacattcagatgctgcgactattgctgagtggaaagatggtctcaatgaa
gcctgggctgacctcctggagctcattgacacgagaacacagattcttgctgcctcttac
gaacttcataagttttaccatgatgccaaggagatctttggccgcatccaggacaaacac
aagaaactccctgaggagcttggaagagatcagaacaccgtggagactttacagagaatg
cacaccacctttgaacatgacatccaagctctgggcactcaggtgaggcagctgcaggag
gatgcagcccgcctccaagcagcctatgcaggggacaaggctgacgacatccaaaagcgt
gagaacgaggtcctggaagcctggaagtccctgctggatgcttgtgagggtcgcagggtg
cggctagtagacacgggagacaagttccgcttcttcagcatggtgcgtgacctcatgctc
tggatggaagatgtcatccggcaaatcgaggcccaggagaaaccccgggatgtgtcatct
gttgaactgttaatgaataatcatcaaggcatcaaagctgaaatcgatgctcgtaatgac
agttttacagcttgcattgaacttgggaaagccctgctggcaaggaaacactatgcttct
gaggagatcaaggaaaagttactgcagttgacggagaaaagaaaagaaatgatcgacaag
tgggaagaccgatgggagtggttaagactgattttggaggtccatcagttctcaagagat
gccagtgtggctgaggcttggctgctgggacaggagccatacctatccagccgcgaaatc
ggccagagtgtggatgaagtggagaagcttattaagcgccatgaggcatttgaaaaatct
gcagcgacctgggatgagagattctctgccctggaaaggttgacaacattggagctactg
gaagtgcgcagacagcaagaggaagaagaaagaaagaggcgaccaccgtctccggagcca
agcgcgaaggtttcagaggaggctgagtcccagcaatgggacacttcaaaaggagaccaa
gtttcccagaatggtttgccggctgagcagggatctccacggatggcaggaaccatggaa
acaagtgaaatggtcaacggtgctgctgagcagaggacaagctccaaagaatccagtcct
gttccttctcccacctcggaccgcaaggccaaatctgcacttccagcccagagtgctgcc
accctgccagccaggaccctggagacgcctgcggcccagatggaaggcttcctcaatcgg
aagcacgagtgggaggcccacaataagaaagcctcaagcaggtcctggcacaatgtttat
tgtgtcataaataaccaagaaatgggcttctacaaagatgccaagagtgctgcttctggc
gtcccctaccacagtgaggtccctgtgagtttgaaagaggccatctgcgaagtggccctt
gattacaagaagaagaagcatgtgttcaagctaagactaagtgatggcaacgagtacctc
ttccaagccaaagatgatgatgaaatgaacacatggatccaggctatcacctctgccatc
tcctctgacaagcacgacacgtctgccagcacccagagtacgccagcatccagccgagcg
cagaccttacccaccagcgtcgtcaccatcaccagcgagtccagtcctggcaagagggag
aaggacaaagagaaagacaaagagaagcggttcagccttttcggcaagaagaagtga

DBGET integrated database retrieval system