KEGG   Rattus norvegicus (rat): 305679
Entry
305679            CDS       T01003                                 

Gene name
Vcl
Definition
(RefSeq) vinculin
  KO
K05700  vinculin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    305679 (Vcl)
   04520 Adherens junction
    305679 (Vcl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    305679 (Vcl)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    305679 (Vcl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    305679 (Vcl)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    305679 (Vcl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    305679 (Vcl)
   04147 Exosome [BR:rno04147]
    305679 (Vcl)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     305679 (Vcl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   305679 (Vcl)
SSDB
Motif
Pfam: Vinculin CARD Flavodoxin_1
Other DBs
NCBI-GeneID: 305679
NCBI-ProteinID: NP_001100718
RGD: 1311217
Ensembl: ENSRNOG00000010765
UniProt: P85972
Position
15p16
AA seq 1066 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVGKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPNASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGASPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEIAALTSKLGDLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLAAQLADLAARGEGESPQARALASQLQDSLKDLKTQMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGRLGATAEKAAAVGAANKSTVEG
IQASVKTARELTPQVISAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDE
VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT
EMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgccggtgtttcacacgcgcacgatcgagagcatcctggagccggtggcgcagcagatc
tctcacctggtgattatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtggccgctgtgcaggcggccgtcagcaacctcgtccgggttgggaaagag
accgttcagaccactgaggatcagattttgaagagagatatgccgccagcatttattaag
gtcgagaatgcttgcacgaagcttgttcaggcagctcagatgcttcagtcagacccatac
tctgttcctgcgcgggattacctcatcgacggctccaggggaatcctctctggaacgtct
gacctcctgcttacctttgatgaggctgaggttcgaaaaattataagagtttgcaaaggg
attttggaatacctcacagtggcagaggtagtggagactatggaagacttggtcacttac
acaaagaaccttgggcccggaatgacgaagatggccaaaatgatcgatgagagacagcag
gagttgacgcaccaggaacaccgtgtgatgctggtgaactcaatgaacactgtcaaagag
ctgcttcctgttctcatttcagctatgaagatttttgttacaaccaaaaactcaaaaaac
caaggaatagaagaagctctgaaaaatcgaaattttactgtaggaaagatgagtgctgag
attaacgagatcattcgtgtgttacaactcacctcctgggatgaggacgcctgggccagc
aaggacactgaagccatgaagagagcgctggcctccatagactcgaaactgaaccaggcc
aaaggttggctccgtgaccccaacgcttccccaggggacgccggtgagcaggccatcagg
cagatcttggacgaagctggaaaagttggtgaactttgtgcaggcaaggaacgcagggag
atcctaggaacctgcaagatgctagggcagatgactgaccaagtggctgacctccgagcc
agaggacaaggagcctcgccagtggccatgcagaaggcccagcaagtgtctcaggggctc
gacgtgcttactgcgaaagtggaaaatgcagctcgaaagctggaagccatgacgaactca
aagcagagtattgcgaagaagattgacgctgcgcagaattggctggcagatcccaatggt
ggacctgaaggagaagaacagatccgaggggctttggctgaagctcggaagattgctgag
ttatgtgatgatcctaaggagagggacgacatcctccgctctcttggagagatagcggct
ctgacctctaaattaggagacttgcgaagacaggggaaaggagactccccagaggctcga
gccttggctaaacaagtggcaaccgcgctacagaacctgcagaccaaaaccaatagggct
gtggccaacagcaggcctgccaaggcagccgtccacctggaaggcaagattgagcaggca
cagcggtggattgataaccctacagtggatgaccgaggagtcggtcaggctgccatccgt
ggacttgtggctgaagggcatcggctggccaatgtcatgatgggaccttatcgccaagat
cttctcgccaagtgtgaccgtgtagaccagctagcagctcagctggctgacctggctgcc
cgaggggagggggagagtcctcaggcgagagcgcttgcttctcagcttcaggactcctta
aaggatcttaaaacccagatgcaggaagctatgactcaagaggtgtccgacgttttcagc
gatactacaactcccatcaagctgttggcagtggcggccactgctcctcctgatgcgccc
aatagggaagaggtatttgacgagagagcagccaactttgaaaaccattcaggaaggctt
ggggccacggcagagaaggcagctgctgttggtgctgccaataaatcgacagtggaaggc
attcaggcatccgtgaagacagcccgagaactcactccccaggtgatctcagctgctcga
atcttactgaggaaccctggtaaccaagctgcgtatgaacattttgagaccatgaagaac
cagtggattgataatgttgagaaaatgacagggctggtggacgaggccattgataccaaa
tctctgttggatgcttctgaagaagcaattaaaaaagacctggacaagtgtaaggtagcc
atggccaatattcagcctcagatgctggtcgctggagcaaccagtattgctcgtcgggcc
aaccggattctgctggttgctaagagggaggtagagaactctgaggatccgaagttccga
gaggctgtgaaagctgcctctgatgaactgagcaaaacaatctcccccatggttatggat
gccaaggctgtggctggaaacatctctgaccctggcctgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaagttagagaagccttccaacctcaggagcct
gacttcccgcctcctccaccagaccttgaacagctacgtctaactgatgagctggctcct
cccaaaccacctctgcctgagggtgaagtccctccacccaggccacccccaccagaagag
aaggatgaagagttccctgagcagaaagccggggaggtgattaaccagccgatgatgatg
gccgccaggcagctccacgatgaagctcggaagtggtctagcaagggcaatgacatcatc
gcagcagccaagcgcatggctctgctgatggcggagatgtctcggctggtaagagggggc
agtggtaccaagcgggcacttattcagtgtgccaaggatatcgccaaggcctctgatgag
gtgacgaggttggccaaggaggttgccaagcagtgcacagataagcggattagaaccaat
ctcttacaggtctgtgagcgaatcccaactataagcacccagctcaaaatcctgtccaca
gtgaaggccaccatgctgggccggaccaacatcagtgacgaggagtctgagcaggccaca
gagatgctggttcataatgcccagaacctcatgcagtctgtgaaagagactgtgcgagag
gccgaagctgcttcaatcaagattcgaacagacgccggatttactctgcgctgggtcaga
aagactccctggtaccagtag

DBGET integrated database retrieval system