KEGG   Rattus norvegicus (rat): 305684
Entry
305684            CDS       T01003                                 

Gene name
Samd8
Definition
(RefSeq) sterile alpha motif domain containing 8
  KO
K22697  sphingomyelin synthase-related protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305684 (Samd8)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    305684 (Samd8)
SSDB
Motif
Pfam: PAP2_C SAM_1 SAM_PNT SAM_2 PAP2
Other DBs
NCBI-GeneID: 305684
NCBI-ProteinID: NP_001012040
RGD: 1306447
Ensembl: ENSRNOG00000013236
UniProt: Q641X0
Position
15p16
AA seq 478 aa
MPARSRAGSRQRSGSLPRPSRLPLEALSSAYAPRTPDSDGAIDTGSELGPGSPAPTAEEV
EEEMAGPSQLCIRRWTPRHVAVWLKEEGFFEYVDILCNKHRLDGVTLLTLTEYDLRSPPL
EIKVLGDIKRLMLSVRKLQKTHIDVLEEMGYNSDSPISPMTPFISALQSADWLCNGEPAH
SCDGPIPDLSSDQYQYMNGKNKHCARRLDPEYWKTVLSCVYVFIVFGFTSFIMVIVHERV
PDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGMILCYIWILVLLLHKHRSILLRRLCSLMG
TVFLLRCFTMFVTSLSVPGQHLQCTGKVYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYM
FSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITT
RLFLYYHTLANTRAYHQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcccgcgcgtagccgagccggctcccgccagcgctccggctccctgccccggccttcg
cgtctgcctcttgaggcgctgagctccgcctacgcgccgaggaccccggactccgacggc
gccatagacaccggctccgagctgggtcccggcagcccggctcccaccgcggaggaagta
gaagaggaaatggcaggccctagtcaactctgcattcgccgctggactcccaggcatgtg
gccgtgtggctgaaggaggaggggttttttgagtatgtggacatcttatgtaacaagcac
cgtctggatggagtcacactgctcacgctcaccgagtatgatctccgctctcctcctctg
gaaatcaaagtcctaggagacattaaacggctaatgctctcagtccgaaaactgcagaaa
acacacattgatgttttggaagagatgggttacaacagtgacagtcccataagtcccatg
acgccattcatcagtgcccttcagagtgcagactggctctgtaatggagagcctgcacac
agctgtgatgggcccatccctgatctgagctctgatcagtaccaatacatgaatggcaag
aacaagcactgtgcccgaagactggaccccgagtactggaagaccgtcctgagctgtgta
tatgtctttatagtatttgggttcacctctttcattatggtcattgttcacgagcgagtg
cctgacatgcagacctacccaccactcccagatatattcttagacagtgttcctaggatc
ccgtgggccttctccatgactgaagtgtgtggcatgatcctgtgctacatctggatcctg
gtcctcctccttcacaagcacaggtcaatccttctgcgaaggctctgtagtctgatgggc
actgtattcttgcttcgctgctttaccatgtttgtgacctccctctccgtgccaggacag
cacctgcagtgtactggaaaggtgtatggaagtgtgtgggagaaactgcatcgggcgttt
gccatttggagtggcttcggcatgactctgacgggcgtgcacacttgtggggattacatg
ttcagtggccacaccgttgtcctaaccatgctgaatttctttgtcacagaatatacgcca
agaagctggaatttcttgcacactctctcgtgggttctcaacctctttggaatcttcttc
atcttggctgcccatgaacattattccattgacgtgtttattgccttttatatcacaaca
agactctttttgtactaccacactctggctaataccagagcgtatcaccagagcaggaga
gcgagaatttggttccctatgttttctttctttgaatgcaatgttaatggcacagtacct
aatgaatattgttggccattttctaaaccagcaataatgaaaagactaattggatga

DBGET integrated database retrieval system