KEGG   Rattus norvegicus (rat): 305795Help
Entry
305795            CDS       T01003                                 

Gene name
Abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    305795 (Abhd6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    305795 (Abhd6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     305795 (Abhd6)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S33
   305795 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 DLH Lipase Thioesterase BAAT_C
Motif
Other DBs
NCBI-GeneID: 305795
NCBI-ProteinID: NP_001007681
RGD: 1359323
Ensembl: ENSRNOG00000008167
UniProt: Q5XI64
Position
15p14
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSVLMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGNVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNRFVQRLKELEDSAATQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVSEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSITNSQVEV
LENCGHSVVMERPRKTAKLVVDFLASVHNPDNNKKLN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgatgtggttaacatgtttgtgattgcgggtgggaccctggccattccgatc
ctggccttcgtagcttctttcctcctttggccctcggcgctgataagaatctattattgg
tactggcggaggacgctgggcatgcaagtccgctacgtgcaccacgaggactatcagttc
tgttactccttccggggcaggccaggacacaagccgtccgtccttatgcttcacgggttc
tccgcacacaaggatatgtggctcagtgtggtcaagttccttcccaagaatctgcacttg
gtctgtgtggacatgcctggacatgaagggaccacccgttcctccctggatgacctgtcc
atagttgggcaagtgaaaaggatacatcagtttgtagaatgccttaagctgaacaaaaag
ccctttcaccttataggcacctccatgggtggcaacgtggctggagtatacgctgcttac
tatccatctgacgtctgcagcctgtctctcgtgtgccctgctggcctgcagtattcaact
gacaatcggtttgtacaacggctcaaagagctggaggactcagccgccacgcagaagatc
cctttgatcccatccaccccggaagagatgagcgagatgctgcagctctgctcgtacgtc
cgcttcaaggtgccccagcagatccttcaaggtcttgtcgacgttcgcatccctcacaac
agcttctaccggaaattgtttttggaaatcgtcagtgagaaatccagatactctctgcat
gagaacatggacaagatcaaggtcccaacacagatcatttggggaaaacaagaccaggtg
cttgatgtgtcgggggcagacatattagccaagtccatcactaactcccaggtagaggtt
ctggaaaactgtggccattcagtggtgatggagagaccgaggaagacagccaagctcgtc
gtcgactttttagcttctgtgcacaacccagacaacaacaagaagctgaactga

DBGET integrated database retrieval system