KEGG   Rattus norvegicus (rat): 305831
Entry
305831            CDS       T01003                                 

Gene name
Atg14
Definition
(RefSeq) beclin 1-associated autophagy-related key regulator
  KO
K17889  beclin 1-associated autophagy-related key regulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    305831 (Atg14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    305831 (Atg14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    305831 (Atg14)
   05014 Amyotrophic lateral sclerosis
    305831 (Atg14)
   05016 Huntington disease
    305831 (Atg14)
   05017 Spinocerebellar ataxia
    305831 (Atg14)
   05022 Pathways of neurodegeneration - multiple diseases
    305831 (Atg14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305831 (Atg14)
   03029 Mitochondrial biogenesis [BR:rno03029]
    305831 (Atg14)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    305831 (Atg14)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    305831 (Atg14)
SSDB
Motif
Pfam: ATG14 Borrelia_P83 Exonuc_VII_L
Other DBs
NCBI-GeneID: 305831
NCBI-ProteinID: NP_001100728
RGD: 1304610
Ensembl: ENSRNOG00000011873
UniProt: D4A4K3
Position
15
AA seq 492 aa
MASPSGKGSWTPEAPGFGPRALAPDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQ
SGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRI
EQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
SDLREHYDRLACLRRLHILELTSVIFPMDEVKTSGRDPADVSSETDSAMTSSMVSKLAEA
RRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPA
YTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQRLTRAVRKLNANILYLCS
SQHVNLDQLQPLHTLRNLMHLVSPHSEHLGRSGPFEVRADLEESMEFVDPGVAGESDVSG
DERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQASPPIASSSAGGMISSAAAS
VTSWFKAYTGHR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgtctcccagtgggaagggttcttggacgcccgaggctcctggctttgggccgcgg
gctctagcaccggacctggtggactcggtggacgacgccgagggcctttacgtggctgtt
gagcggtgtcctctgtgcaacaccactcgccggcggttgacttgcgctaagtgcgtccag
agcggtgatttcgtctatttcgacggccgcgaccgggagaggtttattgacaagaaggaa
aggcttagtcaactgaagaacaaacaagaagaatttcaaaaagaagtactaaaggccatg
gaaggaaaacggctaacagatcagttgcgatggaaaataatgtcctgcaagatgaggatt
gaacagctgaagcaaacgatatgtaaaggaaatgaggaaatgaagaaaaattctgaaggc
ctcctcaagaacaaggaaaagaaccagaagctttacagccgagcgcagcgacaccaagag
aaaaaggagaagattcagcggcacaaccgcaagcttggggacctggtggagaagaaaacc
agtgacctgagggaacactacgatcggttggcgtgtttgcggaggttacacatcctagag
ctcacctctgtcatcttcccaatggatgaagtgaagacttctgggagggaccctgcagac
gtgtcctcagagactgacagtgccatgacctccagcatggtgagcaaacttgctgaggcc
cggaggacgacatacctctccggaagatgggtctgtgacgaccacaacggcgacaccagc
attagcatcacgggcccttggatcagcctgccgaacaatggggactactctgcttactat
aactgggtagaagagaagaaaacaacccaaggacctgacatggagcataacaaccctgcc
tacaccatcagcgccgcgctcggctatgccacgcagctggtcaacattgtgtctcacatc
cttgacatcaaccttcccaaaaagctgtgcaacagtgagttctgtggagaaaacctcagc
aagcagaggctgacccgcgcagtgaggaaactgaacgcaaacatcctttacctttgttct
tctcagcatgttaatttagatcagttgcaacccctgcacacactgaggaacttgatgcat
ctggtcagcccgcactccgagcacctgggcaggtcaggaccttttgaagtgcgagcagac
ctcgaggagtccatggaatttgtggaccctggagttgctggggaatcagatgtgagtgga
gatgagcgtgtgagcgatgaggagactgacctgggcacagactgggagaacctgccaagc
ccacgattctgtgacatcccttcccagccggtggaagtttcccagagccagagcacccag
gcgtcccctcccatagccagcagcagcgctggtgggatgatctcctctgctgcggcctca
gtgacctcctggttcaaagcttacactggacaccgctaa

DBGET integrated database retrieval system