KEGG   Rattus norvegicus (rat): 305844
Entry
305844            CDS       T01003                                 

Gene name
Rnase1l2, RGD1565230
Definition
(RefSeq) ribonuclease, RNase A family, 1-like 2 (pancreatic)
  KO
K01168  pancreatic ribonuclease [EC:4.6.1.18]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    305844 (Rnase1l2)
   04131 Membrane trafficking [BR:rno04131]
    305844 (Rnase1l2)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.18  pancreatic ribonuclease
     305844 (Rnase1l2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA degradation factors
   Other degradation factors
    RNases
     305844 (Rnase1l2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    305844 (Rnase1l2)
SSDB
Motif
Pfam: RnaseA
Other DBs
NCBI-GeneID: 305844
NCBI-ProteinID: NP_001020287
RGD: 1565230
Ensembl: ENSRNOG00000057064
UniProt: Q8VD89
Position
15p14
AA seq 152 aa
MGLEKSLFLFSLLVLVLGWVQPSLGVESRETPAQKFERQHMDEEGPFPSSPTYCNEMMKS
RGMTSGWCKSMNTFVHEPLATVQAICSQGQVTCKNGRNNCHKSSSTLRITDCRLKGSSKY
PNCDYTTTNSQKHIIIACEGNPLVPVHFDDSV
NT seq 459 nt   +upstreamnt  +downstreamnt
atgggtctggagaagtccctctttctgttttcactgcttgtcctggtgcttggatgggtc
cagccttccctgggtgtagaatctagggaaactccagcccagaagtttgagaggcagcac
atggacgaggagggtcccttcccgagcagccccacctactgtaacgagatgatgaagagc
agggggatgacctcggggtggtgcaagtccatgaacaccttcgtgcatgaacccttggca
actgtccaggccatctgctcccagggacaagtgacctgcaagaatgggaggaacaactgc
cacaagagcagctccaccctgcgcatcactgactgccgcctgaagggcagctccaagtat
cccaattgtgactacacaaccactaacagtcagaagcacatcatcattgcttgtgagggg
aaccccctcgtcccagtccactttgatgattccgtgtag

DBGET integrated database retrieval system