KEGG   Rattus norvegicus (rat): 305845Help
Entry
305845            CDS       T01003                                 

Gene name
Mettl17, Mett11d1, RGD1559895
Definition
(RefSeq) methyltransferase like 17
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Rsm22 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 MTS
Motif
Other DBs
NCBI-GeneID: 305845
NCBI-ProteinID: XP_001053790
RGD: 1559895
Ensembl: ENSRNOG00000025512
UniProt: D3Z930
Position
15p14
AA seq 461 aa AA seqDB search
MATARASRFLLLFCRSCRSLRGPQSRAFAALVPGVSQVDNRSDFLGKKPHRKHPGILHLP
HVHLPQALTDAAQLLLLERPKRSVEKQVQALTNYLWSRHLPVEPEELQRRAAYLEKKFLE
KQDSTQTEEKLREAVLHALRKTTYHWQELSYNEELSLIYMAARLDGGFAAVFRAFHEIQA
RIPEFQPQTLMDFGSGTGSVAWAAHSTWGQSLREYVCVDRSAAMLGLAEKLLKGGSESGK
PCIPGVFFRQFLPVSPKVQFDVVVSAFALSELPSRADRTEVLQNLWRKTSHFLVLVENGT
KAGHRLLMDARNLILGDKEKSPLDLRPSFVFAPCPHELPCPQLNAAKSLACSFSQAYQPI
PFHWNKKPKEETFSMVILARGSPKEANRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVVT
ARRHGRDLYRCARVSSWGDLLPVISPSEFPPPSPAEEPPES
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccagggcatcgagatttctgctgctgttctgcagatcgtgccgcagcctt
cgaggaccccagtcccgagcattcgctgcccttgtgcccggtgtgtcccaggtagacaac
aggtccgatttcctggggaagaagccccatcgcaagcatccgggcatcctgcatcttccg
cacgtacatctgccgcaagcactgactgacgccgcgcagttactgcttcttgagagaccc
aagcgcagtgtagagaagcaggtgcaagcactcaccaactatctctggagccgacattta
ccagtagagccggaggagttgcaaagacgggccgcctatcttgagaagaaatttctggaa
aaacaagactcaactcagacagaggaaaaacttcgtgaggcggtactgcacgccctgcgc
aaaactacctaccactggcaggaactcagctacaatgaagaactgagcctgatctatatg
gcagcaagattggacggtggttttgctgcagttttcagggcattccatgagatccaggct
cgaatcccagagttccagccacagacgttgatggacttcgggtctggcactggttctgtt
gcctgggctgctcatagtacttggggccagagcctgcgtgaatacgtctgtgtggaccgt
tcagctgccatgttgggtctagctgaaaagctccttaaaggtggttcagaatcagggaag
ccctgtatcccaggtgtctttttcagacagtttctacctgtgtcacccaaggtccagttt
gacgtagtagtatcagccttcgccctcagtgaactacccagcagggccgatcgcactgag
gtacttcagaacttgtggcgtaagacaagccattttctggtattggtggagaacggaaca
aaagctgggcaccgacttctcatggacgccaggaacctgatcctcggggacaaagagaag
tcgcccctggacctgcgacctagctttgtctttgccccatgtccccatgaacttccttgt
cctcagctgaacgccgccaagtccctggcctgtagcttctcccaggcctatcagcctatc
ccctttcactggaataagaaaccaaaggaggaaacgttctccatggtaatccttgccagg
ggttctccaaaggaagctaaccgctggccccgaatcacgcagcctgttcttaaacggcct
cgccatgtgcattgtcacctctgttgtccagatgggcacatgcagcacgctgtggtcaca
gcccgtcggcacggcagggatttatatcgctgtgcccgcgtcagctcctggggagacctt
ttacctgtgatctctccatccgagtttcctcctccgtccccggctgaagagccccctgag
agttga

DBGET integrated database retrieval system