KEGG   Rattus norvegicus (rat): 305853Help
Entry
305853            CDS       T01003                                 

Gene name
Rab2b
Definition
(RefSeq) RAB2B, member RAS oncogene family
  KO
K07878  Ras-related protein Rab-2B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305853 (Rab2b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    305853 (Rab2b)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    305853 (Rab2b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    305853 (Rab2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3 AAA_24
Motif
Other DBs
NCBI-GeneID: 305853
NCBI-ProteinID: NP_001032734
RGD: 1309117
Ensembl: ENSRNOG00000012488
UniProt: Q3B7V5
Position
15p14
AA seq 215 aa AA seqDB search
MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNK
SDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIHRKIQQGLFDVHN
EANGIKIGPQQSISLVGPCPSQQNSSDIGPDSGCC
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgcttatctcttcaagtacatcatcatcggagacacaggtgtggggaagtca
tgtctcctccttcagtttaccgacaagcggttccagcctgtgcacgacctcacaataggt
gtggagtttggagcacgtatggtcaacatcgatggaaagcaaatcaaactgcaaatctgg
gatacggctgggcaagagtccttccgttctatcacccgttcctactacaggggagcagct
ggagccctgctggtgtatgacatcacaagacgtgaaaccttcaaccacctgacctcatgg
ttagaggatgcccgccagcactccagctccaacatggttataatgctgattgggaataag
agtgatctagaatctcgaagggatgtgaaaagagaagaaggagaggcctttgctcgtgag
catggccttatattcatggaaacatcagccaagacagcctgcaatgtcgaagaggcctac
attaatacagccaaagaaatacataggaagatccagcaaggtttatttgatgtccacaat
gaggcaaacggcatcaagattgggccccagcagtcgatctcattggtggggccatgcccc
tctcagcagaactcctccgacatagggcctgactctggctgctgctga

DBGET integrated database retrieval system