KEGG   Rattus norvegicus (rat): 305884
Entry
305884            CDS       T01003                                 

Gene name
Acin1
Definition
(RefSeq) apoptotic chromatin condensation inducer in the nucleus
  KO
K12875  apoptotic chromatin condensation inducer in the nucleus
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    305884 (Acin1)
  09122 Translation
   03013 RNA transport
    305884 (Acin1)
   03015 mRNA surveillance pathway
    305884 (Acin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    305884 (Acin1)
   03041 Spliceosome [BR:rno03041]
    305884 (Acin1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     305884 (Acin1)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    305884 (Acin1)
SSDB
Motif
Pfam: RSB_motif SAP RRM_1
Other DBs
NCBI-GeneID: 305884
NCBI-ProteinID: NP_001163939
RGD: 1311945
Ensembl: ENSRNOG00000013533
UniProt: E9PST5
Position
15
AA seq 1339 aa
MWRRKRPNSSGGTRGILSGNRGVDYGSGRGQFGTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMTHPEGVA
SLLPPDFQSSLDRPELELSTHSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQARAKLPE
YSQAAEEEEDQETPSRNLRVRADRNLKVEEEEEEEEEEDDEEEEEEVDEGQKSREAEAPI
LKQFEDEDGEEMTRAKPEKVVDEKPPIIRSQEKDELEKGGRVTRSQEEARRSHLARQQQE
KETQIVSLPQEENEVKSSQGLEEKSQSPSLPPLPEDLEKAPVVLQPEQIVSEEETPPPLL
TKEASSPPTHMQLQDEEEVEPAEGPAPPVLIQLSPPGTDAGTREPIVSPHTVQLLRGLSP
LSSTADTKAESPAERVSEESVLPLAQRSILPEHSAQKGAESEREKSAPLLPLTREELAPA
KGITEESVKKQSLEQEEGRRASHTLFPDHSLKPSADSSSSRSSSPSSSSSRSRSRSPDSS
ASRSQSSPRSKQREVSQARVHANPHDRAKMGSRSTSESRSRSRSRSRSASSGSRKSLSPG
VSRDGNTTYTETKDPSCGQEAAAPSVPQLQVLEPKEKAPTCSASVRGRHMSQPEPEQKHV
IQRLQPEQESPKKCEAEEAEPPAATQPQTSEPQLSQLPEAERTPHTAEEKEDVTMDTSEN
RPENEVPEPPVPIADQVSNDDRPEGSAEEEERKESSMPKSFKRKISVVSATKGVQAGNSD
TEGGQPGRKRRWGASTAATQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISE
DETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEKEPEAEPPAPPQASVEAAL
PPPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLV
RPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPK
FLCADYAEQDELDYHRGLLVDRPSEAKTEEQGAPRPLHPPPPPPVQPPPHPRAEPREQER
AVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE
KAQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQIVQKEAEQAERAKEREKRRKEREEEEQ
KEREKEAERERNRQLEREKRREHSRERERDRERERDRGDRDRDRERDRDRGRERDRRDTK
RHSRSRSRSTPVRDRGGRR
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgtggagacggaaacgaccgaacagttccggaggaacccggggaattctgagcggtaat
agaggggtagactatggcagtgggcggggccagttcggtacgttcgaagggcgttggcgg
aaattaccgaagatgcccgaagccgtcgggacggacccgagtacctcacgcaagatggcg
gagctggaggaggtgactctggacgggaagcctcttcaggctctgcgggtgaccgacctg
aaggccgcactggagcagcgaggcctagccaagagcgggcagaagagtgccctggtcaag
cggctcaaaggggctctaatgctagaaaatttacaaaaacactcaacaccccatgctgca
ttccagccaaattctcagattggggaggagatgagccagaacagtttcataaagcagtac
ctggaaaagcagcaggagctacttaggcagcgcctagaacgggaagctcgagaggctgca
gaacttgaagaagcttcagctgagtcggaggacgagatgacccatcctgagggagtggct
tccctgctgcctcctgactttcagagcagcctggacagaccagagctggagctcagcaca
cattcacctcgaaagagctcctctttttctgaagagaaaggtgaatccgatgatgagaaa
ccaaggaaaggagaaagacgatcatcccgggtcagacaggcaagagctaaactccctgag
tacagtcaggctgctgaggaggaagaggaccaagagacgccatctagaaacctgagggtc
agagcagatcgaaatttaaaagtagaggaggaggaggaagaggaggaagaagaagatgat
gaagaagaggaagaggaggtagatgagggacagaaatctagagaagccgaggcaccaatc
ctgaaacagtttgaggatgaagacggggaggagatgaccagagcaaaaccagaaaaggta
gtggatgagaaacccccaatcataagatcccaggaaaaggatgagttagagaaaggaggg
cgagttacaagatcccaggaagaagctagaagaagtcatctggccagacaacaacaagag
aaagagacacaaattgtttctctccctcaagaagaaaatgaggtaaaatcttcacaaggt
ttggaagaaaaatcccagtctccttccctgcctcccctccctgaagacctagagaaggcc
cctgtcgtgctgcagccagagcaaatagtcagtgaagaggaaacacccccacctttactt
accaaggaagcttcatctccaccaactcatatgcagctccaggatgaagaagaagtggag
ccagcggaaggcccagcaccccctgtcctcattcagttatctcctcctggtacagatgct
ggaaccagggagcccatagtgtctccccacacagtgcagctgctcagaggcctgtctcct
ctgtcaagtactgcagacaccaaagcagagtctccagcagagagagtgtcagaagagagt
gtcctgcccctggcacagagaagcatactgcccgaacactcagcccagaaaggtgctgaa
agtgagcgtgaaaagtctgctccccttctccctctaacaagagaggagttagcacccgcc
aaagggatcactgaggagtctgtgaagaaacagtctttggaacaggaggagggcagaaga
gcttcccacactctcttcccagaccacagtttgaaaccgtcagccgactcatcctcgagc
cgatcatcctcaccttcatcctccagctctagatccagatctcgatctcctgacagttca
gcttcccgctcacagtcctctccaagatctaaacagagagaggtgtctcaagcgcgagtt
cacgccaatcctcatgatagagccaagatgggctccaggtcaacatcagagtctaggtca
cgttctcgatctcgttcccgttccgcatcaagcggcagcagaaaatctctgagccctgga
gtctccagagacggcaacaccacctacactgaaaccaaagatccctcttgtggtcaggag
gctgcagctccatcagtgccacagctgcaggtccttgaaccaaaggagaaggctcccacg
tgctcagcctctgtccgggggaggcatatgagccagcctgagccagagcaaaagcacgtg
atccagaggttacagccggagcaggagagcccaaagaagtgtgaagctgaagaggcagag
ccaccagctgccacccagcctcagacctcagagcctcagctctctcagctgccagaggcg
gaaaggactcctcacaccgctgaagagaaggaggacgtgaccatggacacaagtgaaaac
agacctgaaaatgaggttcctgagcctcctgtgcctattgcagaccaagtcagcaatgat
gaccgcccagaaggcagtgctgaagaagaggagaggaaagagagctcgatgcccaaatca
ttcaagaggaaaatctccgttgtctcagctaccaagggggtgcaagctggaaacagtgac
acagaggggggccagcctggtcgaaagcgtcgttggggagccagtactgctgccacacag
aagaaaccttctatcagtatcaccactgagtcactcaagagcctcatccccgacatcaaa
cccctggcggggcaggaggctgttgtggatcttcatgctgatgactcccgaatctctgag
gatgagacagagcgtaatggcgacgatgggacccatgacaaaggactgaaaatatgccgg
acagtcactcaggtagtacctgcagagggccaggagaacgggcagagggaagaggaagaa
gagaaagagcctgaagcagagcctcctgcgcctccccaggcgtcggtggaggctgccttg
cccccacctgtggagcatgaagtaaagaaagtaacattaggagataccttaacccggagg
tccattagccaacagaagtctggagtttccattacaattgatgacccagtccgaactgcc
caggtgccctccccacccaggggcaagatcagtaacattgtccacatctccaacttggtt
cgtcccttcactctaggccagctaaaggagttattagggcgtacagggactttggtggag
gaggccttctggattgacaagatcaaatctcattgctttgtgacgtactcaacagtagag
gaagccgtggccacccggacagctctgcacggggtcaagtggccccaatccaaccccaaa
ttcctctgtgctgactatgctgagcaagatgagctggactatcaccggggactcttggta
gatcggccatctgaagctaagacagaggaacagggagcaccaaggcccttgcatccccca
cccccacccccagtccagccaccacctcatcccagggctgagccacgggagcaggaaagg
gctgtacgggagcagtgggcagaacgggaacgggaaatggagcggcgggagaggactcgg
tctgagcgagaatgggatcgggacaaagttcgagaggggccccgctcccgatcacggtcc
cgtgaccgccgccgcaaagagcgagcaaaatctaaagaaaagaagagtgagaagaaagag
aaagctcaggaggagccgcctgccaagttgctggatgacctcttccgtaagaccaaggca
gctccctgcatctattggctcccactgactgagagccagattgttcagaaggaggcagag
caagcagaacgggccaaggagcgggagaagcggcgaaaggaacgagaagaagaagaacag
aaggagcgggagaaggaagctgagcgggaacggaaccgacagctagaacgggagaaacgg
agggagcacagcagggagagagagagggacagggaaagagagagggacaggggcgaccga
gatcgggacagggaaagagaccgagaccgaggcagggagagggatcgcagagacaccaag
cgacacagcagaagccggagtcgaagcacacctgtacgggaccggggtgggcgccgctag

DBGET integrated database retrieval system