KEGG   Rattus norvegicus (rat): 305896
Entry
305896            CDS       T01003                                 

Gene name
Irf9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    305896 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    305896 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    305896 (Irf9)
   04625 C-type lectin receptor signaling pathway
    305896 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    305896 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    305896 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    305896 (Irf9)
   05171 Coronavirus disease - COVID-19
    305896 (Irf9)
   05164 Influenza A
    305896 (Irf9)
   05162 Measles
    305896 (Irf9)
   05168 Herpes simplex virus 1 infection
    305896 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    305896 (Irf9)
   05169 Epstein-Barr virus infection
    305896 (Irf9)
   05165 Human papillomavirus infection
    305896 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    305896 (Irf9)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    305896 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 305896
NCBI-ProteinID: NP_001012041
RGD: 1308766
Ensembl: ENSRNOG00000019478
UniProt: Q68FP4
Position
15
AA seq 398 aa
MATGKARCTRKLRNWIVEQVESGQFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAIFK
AWALFKEKHKDGDIGNPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRILPAGTL
PTQPRNQKSPFKRSISSVSPERGECKENGIVSHSDSGSNVCGGGSNGGGSSDSCGSTSSS
ELEEGAGTTEATVQEDPVFMENPLPPNSDYSLLLTFIYGGRVVHEIQVHSLDCRLVAEPS
DPESSMVQQVVFPRPDPLEPTQSLLNQLERGILVASNSRGLFVQRLCPIPISWNAPEAPP
GPGPHLLPSNKCVELFSTTYFCRDLAQYFQGQGPLPKYQATLHFWDRSPSSSYTQENLIT
VRMEQAFARNLLEKIPEEEKAALFLVQHTEHQPATLAL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggccacaggcaaagcacgctgtacccgaaagctccggaactggatagtggaacaggtg
gaaagtgggcagttcccaggggtgtgctgggacgacgcagccaagaccatgttccggatt
ccctggaagcacgcaggcaagcaagacttccgagaagaccaggatgctgccatattcaag
gcctgggcactgtttaaggaaaagcacaaagacggggacataggaaaccctgctgtctgg
aagactcgcctacgctgtgccctcaacaagagttccgaatttgaggaggttcccgagaga
ggccggatggatgttgcagaaccctacaaagtatatcgaatactgccagcaggaaccctc
cccacccaaccaagaaaccagaaatcgccattcaagcgaagtatcagttctgtgtcacct
gagaggggagagtgtaaggaaaatgggattgtaagccactcagacagcggcagcaatgtc
tgtggtggtggcagcaacggtggcggcagcagtgacagctgtggcagcaccagcagctct
gagctagaggaaggagctggcacaactgaagccaccgttcaagaggacccagtgttcatg
gagaatccgcttcctccgaactcagactactcgctgctgctcaccttcatctatggcggg
cgcgtggtgcatgagatccaggtgcacagcctagactgtcggcttgtggctgagccctca
gacccggagagcagcatggtgcagcaggtggtgtttcccagacctgacccactggagccc
acccagagcctgctgaatcagctcgagagaggcatcctggtggccagcaattccagaggc
ctctttgttcagcgcctctgccccatccccatctcctggaacgcacccgaggccccacct
gggcctgggcctcatctgctgcccagcaataagtgtgtggagctcttcagtaccacatac
ttctgtagagatttggcccagtacttccagggccagggacctctacccaagtaccaagca
acactgcatttctgggacaggagtcctagctctagctatacccaagagaatcttatcacg
gtgcggatggagcaggcctttgcccgaaatttactagagaagattccagaagaggagaaa
gctgccttgttcctggtacagcacacagagcaccaacctgccactctcgcactctga

DBGET integrated database retrieval system