KEGG   Rattus norvegicus (rat): 305910
Entry
305910            CDS       T01003                                 

Gene name
Pspc1
Definition
(RefSeq) paraspeckle component 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RRM_1 NOPS RRM_7
Other DBs
NCBI-GeneID: 305910
NCBI-ProteinID: NP_001020843
RGD: 1310122
Ensembl: ENSRNOG00000020782
Vega: OTTRNOG00000001148
UniProt: Q4KLH4
Position
15p12
AA seq 522 aa
MMLRGNLKQVRIEKNPARLRALESAAGESEPVAAAAMALTLAGEQPPPPAPSEEHPDEEM
GFTIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGF
IRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGP
VEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDE
DGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAK
EKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRREE
EMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGTQGPPPM
MGMNMNNRGTIPGPPMGPGPAMGPEGAANMGTPMIPDNGAVHNDRFPQGPPSQMGSPMGN
RTGSETPQAPMSAVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgatgttaagaggaaacctgaagcaagtacgtattgagaaaaatccggctcgccttcgc
gccctggagtcggcggccggagagagcgagccggtggccgcggcggccatggcgctgacg
ctggccggggagcagccgccgccacccgctccttcggaggagcacccggacgaggagatg
ggcttcaccattgacatcaagagtttcctcaagcccggcgagaagacgtacacgcagcgc
tgccgcctcttcgtgggtaacctgcccaccgacatcacggaggaggacttcaagcggctc
tttgagcgctacggcgagcccagcgaggttttcatcaaccgcgaccgaggcttcggcttc
atccgcctggaatccagaacactggctgaaattgcaaaagcagagttggatggtaccata
ctgaagagcagacctctccgaattcgctttgctacacatggagcagccctaacagtcaag
aacctgtctccagttgtttccaatgagcttctagagcaagcattttcccagtttggtcca
gtagagaaagctgtcgtggttgtggatgatcgtggtagagctacaggaaaaggttttgta
gaatttgcagcgaaacctcctgcacgaaaggctctggagagatgtggtgatggggcgttc
ttgctaacaacaacacctcgtccagtcattgtagaacccatggagcagtttgatgatgaa
gatggtttgccagagaagctaatgcagaaaactcaacagtaccataaggaaagagaacag
ccaccacggtttgctcaacctgggacatttgaatttgaatatgcatctcgatggaaggct
ctggatgaaatggagaagcagcagcgtgaacaagttgatagaaacatcagagaagccaag
gagaaactggaggcagagatggaagccgctagacatgaacaccagttaatgctaatgagg
caagatctaatgagacgtcaagaagaactcagacgcttggaagaactcagaaatcaagaa
ctgcagaaacgaaagcaaatacaactgagacatgaagaggaacatcgtcgtcgtgaagaa
gaaatgatcagacacagagaacaggaggaactgaggcgacagcaggagggctttaaacca
aactatatggaaaatagagaacaggaaatgagaatgggtgatatgggtccccgtggagca
ataaacatgggagatgcatttagcccagcacctgctggtacccaagggcctcctccaatg
atgggtatgaatatgaacaacagaggaactatacctggcccaccaatgggtcctggtcct
gccatgggaccagaaggagctgcaaatatgggaactccaatgataccagataatggcgca
gtgcacaatgataggtttccccaaggtcctccatcccaaatgggttcgcctatgggaaac
agaacaggttctgaaaccccccaggcaccaatgagtgctgtagggcctgtgagtggtggt
cctggtggctttggcagagggagtcaagggggcaattttgaaggccctaataagcgtcgg
agatattaa

DBGET integrated database retrieval system