KEGG   Rattus norvegicus (rat): 305922
Entry
305922            CDS       T01003                                 

Gene name
Lats2
Definition
(RefSeq) large tumor suppressor kinase 2
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    305922 (Lats2)
   04392 Hippo signaling pathway - multiple species
    305922 (Lats2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    305922 (Lats2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     305922 (Lats2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  NDR family
   305922 (Lats2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C UBA APH Kdo Pox_ser-thr_kin CBP66 Kinase-like
Other DBs
NCBI-GeneID: 305922
NCBI-ProteinID: NP_001100737
RGD: 1305906
Ensembl: ENSRNOG00000056343
UniProt: A0A0G2K4A8
Position
15p12
AA seq 1042 aa
MRPKTFPATTYSGNSRQRLQEIREGLKQPAKSSTQGLLVGPNSDTSSLDAKVLGNKDASR
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLVPTAVTRRPSFEGTGEAF
PSHHQLGGANYEGPAALEEMPRQYLDFLFPGASVHGAPAHQHPPKGYSTAVDAGTHFPGA
HYGRAHLLSEQPGYGVQRSPSFQSKTPPDTYSSLAKAQGGPPASLTFPAHAGLYTTSHHK
PAAAVPGAHPLHVLGTRGPTFTGDSSTQAVLAPSRNSLNNDLYELGSPVPWPAAPLARRD
SLQKQSLEASRPHVAFRAGPSRTNSFSSPQPEPSLPAPNTVTAVTAAHILHPVKSVRVLR
PEPQTAVGPSHPAWVPAPTAPAAAEGLESKEGSAGPPPLDMDFGGSERRCPPPPYPKHLL
LPSKSEQYSAGLDRLCTGVEQSLRGGTEQDRNDKGHKGAKGDKAGRDKKQIQTSPVPVRK
NSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVSRRLQLEQEMAKAGLCETEQE
QMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKK
DVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEV
FPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNS
KYYQKGNHIRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAP
EVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPTQVKLSA
EARDLITKLCCAADCRLGRDGADDLKAHPFFSTIDFSRDIRKQPAPYVPTISHPMDTSNF
DPVDEESPWHEASGESAKAWDTLASPNSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPA
ESADPGDAELGGAVEGCQPVYV
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgaggccaaagacttttcctgctacaacttactctggaaatagccggcagcgactgcaa
gagattcgagaaggactgaagcagccggccaagtcttccacccaggggctgctggtggga
ccaaacagtgacacttcttccctggatgccaaagtcctggggaacaaagatgcctccagg
cagcagcagatgagagccaccccgaagtttggaccttatcaaaaagcgctcagggaaatc
cgatattccctcctgccttttgccaatgagtcaggcacgtcggcagctgcagaggtgaac
cggcagatgctgcaggagttggtgaatgcaggatgtgaccaggagatggctggcagagcg
ctcaagcagacaggcagtaggagtattgaagccgccttggagtacatcagtaagatgggc
tacttggaccccaggaatgagcaaattgtgcgagtcatcaagcagacctccccaggaaag
ggcctggtgcccactgcagtgactcgacgacccagctttgagggcacaggggaagcattc
ccatcccaccaccagttgggcggtgcaaactatgagggccccgctgccctggaggagatg
ccacggcaatatttagacttcctcttccccggggccagcgtccacggcgccccggctcac
cagcatccccccaaaggctacagcactgcagtggatgcgggcacacacttcccaggcgca
cactatggtcgtgctcatctactgtcagagcagcctgggtatggggttcagcgcagcccc
tccttccagagcaagacgccaccagacacctattccagcctggccaaggcccagggtggc
cctcctgccagcctcaccttccctgcccatgctggtctgtacaccacctcgcaccacaag
ccagcggctgcagtacctggggcccaccccttacatgtgttgggcacccggggccccacg
ttcactggggacagctctacgcaggccgttctggcaccgtccaggaacagcctcaataat
gacttgtacgagctgggctctcccgtgccctggcccgcagctccactggcacgccgtgac
tcgctgcagaagcagagtctagaggcctcccggccgcatgtggccttccgggctgggccc
agcaggaccaactccttcagcagcccacaacctgagccctcactgcccgcccccaacaca
gtcactgctgtgacggctgcacacatccttcaccctgtgaagagcgtgcgcgtgctgcgg
cccgagcctcagacagccgtggggccctcgcaccccgcctgggtgcctgcccccacagca
cctgcagccgccgagggcctggagagcaaggagggcagtgcaggcccacccccgctggat
atggacttcgggggctccgagcgcaggtgcccaccgcctccttacccaaagcacttgctg
ctgcccagtaagtctgagcagtacagcgctggtctggaccgcctgtgcaccggtgtggag
cagagtctgcgcgggggcaccgagcaagacaggaatgacaagggccacaagggtgctaag
ggggacaaagctggcagggacaaaaagcagatccagacctccccagtgcctgtccgcaag
aatagcagggatgaagagaagagagagtctcgaatcaagagttactccccatatgccttc
aaattcttcatggaacaacatgtggagaatgtcatcaaaacctaccagcagaaggtcagc
cggaggctacagctggagcaggaaatggccaaagctggactgtgcgagactgagcaggag
cagatgaggaagatcctctaccagaaggagtcgaactacaacagactcaagagggccaag
atggacaagtccatgtttgtgaaaatcaaaactctgggcattggtgcctttggagaagtg
tgccttgcctgtaaggtggatactcacgctctgtatgccatgaagacgctgaggaaaaaa
gatgtcctgaaccggaaccaagtggcccatgtcaaggctgagagggacatcctggctgaa
gcagacaatgagtgggtggtcaaactctactattccttccaggacaaggacagcctgtac
tttgtgatggactacatacctggtggggacatgatgagcctgctgatccggatggaggtc
ttccctgaacacctcgcccgcttctacatcgcagagctgactctggccattgagagtgtg
cacaagatgggcttcatccacagggacatcaagcctgacaacatcttgattgacctggat
ggtcatattaagctgaccgattttggcctctgcactggattcaggtggactcacaattcc
aagtactaccagaaagggaaccacatcagacaggacagcatggagcctggtgacctctgg
gacgacgtttccaactgtcgttgtggagacaggttgaagaccctggagcagagagcacag
aagcagcaccagaggtgcctggcacattctctggttgggacaccaaattacattgctcct
gaggtgcttcttcgcaaagggtacacacagctctgtgactggtggagtgtcggtgtgatt
ctttttgagatgctggttgggcagccacctttcttggcgcccacccccacagaaacccag
ctgaaggtgatcaactgggagaacacgctgcacatccctacgcaggtgaaactcagtgct
gaggcccgagacctcatcaccaagctgtgctgcgcggctgactgccgcctgggcagggac
ggggcagatgacctcaaggcacacccgttcttcagcaccatcgacttttcccgtgacatc
cggaaacagcctgcaccctacgtccccaccatcagccaccccatggacacctccaatttt
gacccagtggatgaagaaagcccctggcacgaggccagcggagaaagtgccaaggcctgg
gacacgctggcgtcccccaacagcaagcacccagagcacgccttctatgagttcaccttc
cgcaggttcttcgacgacaatggctatcccttccggtgcccgaagccctcagagccggct
gagagtgcagacccaggggatgcagagttaggaggtgcggtcgagggctgccagccagtg
tatgtgtaa

DBGET integrated database retrieval system