KEGG   Rattus norvegicus (rat): 305956Help
Entry
305956            CDS       T01003                                 

Gene name
Wdfy2
Definition
(RefSeq) WD repeat and FYVE domain containing 2
  KO
K23532  WD repeat and FYVE domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    305956 (Wdfy2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    305956 (Wdfy2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 FYVE Nucleoporin_N ANAPC4_WD40 FYVE_2 DUF2688 DZR
Motif
Other DBs
NCBI-GeneID: 305956
NCBI-ProteinID: NP_001100739
RGD: 1307337
Ensembl: ENSRNOG00000010042
UniProt: D4A0J0
Position
15p12
AA seq 327 aa AA seqDB search
MSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMVLFVLELEWVLSTG
QDKQFAWHCSESGQRLGGYRTSAVASGLQFDVESRHVFIGDHSGQVTILKLEQENCTLLT
SFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDKVQALSYAQH
TRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHH
CRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVH
FDATRGWLLTAGTDKVIKLWDMTPVVS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaacccggaaacgagaagactgtccataggtctagacaatggtacaatctca
gagtttattttatctgaagattataacaagatgacacctgtgaaaaactatcaagcacat
cagagcagagtgacgatggtcctgtttgttctggaactggagtgggtgctgagcacagga
caggacaagcagttcgcctggcactgctctgagagtgggcagcgcctgggaggttaccgc
accagtgctgtggcctcgggtctgcaatttgatgttgaaagccgtcatgtttttattggt
gatcactcgggccaagtaaccatcctcaaactggaacaagaaaactgcacgctgctcacg
tcctttagagggcacacaggaggggtgacagcactctgctgggacccggtccagcgcgtg
ctattctcaggcagttccgatcactctgtcatcatgtgggacatcggcgggagaaaaggg
acggccatcgagctccaaggacacaatgacaaagtccaggccctctcctatgcgcagcac
acacgacagctcatctcctgtggtggcgacggtggcattgtcgtctggaacatggatgtg
gaaaggcaggagacccctgagtggttggacagtgattcctgccaaaagtgtgaccagcct
ttcttctggaacttcaagcaaatgtgggacagtaagaaaattgggctgagacagcaccac
tgccggaagtgtgggaaggccgtgtgcggcaagtgcagctccaagcgctcttccatcccc
ctcatgggctttgagtttgaagtgcgggtctgcgacagctgccacgaggccatcacagat
gaagaacgcgcacccacagccaccttccatgacagcaagcataacattgtacatgtacat
tttgatgcaaccaggggatggctactgactgctggaactgacaaagtgattaagttgtgg
gacatgaccccagtggtgtcatga

DBGET integrated database retrieval system