KEGG   Rattus norvegicus (rat): 305963
Entry
305963            CDS       T01003                                 

Gene name
Pinx1, RGD1566025
Definition
(RefSeq) PIN2/TERF1 interacting, telomerase inhibitor 1
  KO
K11135  Pin2-interacting protein X1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    305963 (Pinx1)
   03032 DNA replication proteins [BR:rno03032]
    305963 (Pinx1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    305963 (Pinx1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     305963 (Pinx1)
SSDB
Motif
Pfam: G-patch G-patch_2
Other DBs
NCBI-GeneID: 305963
NCBI-ProteinID: NP_001076806
RGD: 1566025
Ensembl: ENSRNOG00000012012
UniProt: A4L691 B0BMT3
Position
15p12
AA seq 331 aa
MSMLAERRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKV
KNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKIS
KNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTS
AFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKR
HKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKR
RAKKTLQRPGGVAVDTAPDSAPVKKKKKVSR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtcgatgctagcggagcgtcggcggaagcagaaatgggctgtggatcccagaaatact
gcgtggagtaatgatgattccaagtttggccagaagatgcttgagaagatggggtggtct
aaaggaaagggtttgggggctcaggagcaaggagccacagaacatattaaagttaaagtt
aaaaataaccacctgggacttggagctacaaacaataatgaagacaactggattgctcac
caggatgacttcaaccagcttttggcagcactcaacacttgccatggtcaggaaacagca
gactcctcagacaacaaggaaaagaaatcttttagccttgaagaaaaatccaaaatctcc
aaaaaccgggttcattatatgaaattcaccaaagggaaggacctgtcctctcggagcgaa
accgacctggattgtatttttggaaaaaggaggaacaagaagcttgctcaggacggctgc
agcaactccactgcggatgaggcggacacctccctgaccacgaccacaaccacaaccagt
gccttcaccatccaggaatattttgccaagaggatggcccagttaaagagcaagtcacag
gccgcagctccagggtctgacctttcagagacccccattgaatggaaaaagggaaagaaa
aaaaccaaagaggcagcaggcacagatatagagaactctccccaacacaaggccaagcgg
cataaaaagaagaagcgagtggaagcagagagggggcctgcggccaagaagagagaccaa
gtcgagctgcagcctggaggccccagtggggacgagtgttccgacgcctctgtggaggct
gcagaggatcgtgtgcagacaccagacacccaggatgatgtcccaaagcccaggaagagg
agagcaaagaagacgctgcagaggccaggaggagtggcagtagacactgcaccggacagc
gcaccagtgaagaagaagaagaaagtttccagatag

DBGET integrated database retrieval system