KEGG   Rattus norvegicus (rat): 305967Help
Entry
305967            CDS       T01003                                 

Gene name
Kif13b
Definition
(RefSeq) kinesin family member 13B
  KO
K17914  kinesin family member 13
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    305967 (Kif13b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     305967 (Kif13b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin DUF3694 Microtub_bd Kinesin_assoc CAP_GLY KIF1B FHA Yop-YscD_cpl C2-C2_1 KMP11
Motif
Other DBs
NCBI-GeneID: 305967
NCBI-ProteinID: NP_998791
RGD: 1303307
Ensembl: ENSRNOG00000013089
UniProt: Q70AM4
Structure
PDB: 

Position
15p12
AA seq 1767 aa AA seqDB search
MGDSKVKVAVRVRPMNRREIDLHTKCVVDVEANKVILNPINTNLSKGDARGQPKIFAYDH
CFWSMDESVREKYAGQDDVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQP
GLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLKVREHSVLG
PYVDGLSKLAVTSYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSG
TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQGAGKNKN
KFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIINHAVVN
EDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEE
IAQERQKQLESLGISLQTSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQD
IQLCGMGILPEHGIIDIMPEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFF
RLNLPKKKKKAEREDEEREASLKNDSSSEQLDADGDSSSEVSSEINFNFEYAQMEVTMKA
LGSNDPMQSILSSLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPERQNCRGVDRLSFH
SPSAQQRLRQWAEEREATLNNSLMRLREQIVKANLLVREASYIAEELDKRTEYKVTLQIP
ASSLDANRKRGSLLSEPAIQVRRKGKGKQIWSLEKLENRLLDMRDLYQEWKECEEDSPVS
RSYFKRADPFYDEQENHSLIGVANVFLETLFYDVKLQYAVPIINQKGEVAGRLHVEVMRL
SGAIGERIAGGDDPTEVSSEKEVQENRLVCMVKILQATGLPQHLCHFVFCKYDFWDQQEP
VTVAPEVDTSSSPTSKEPQCMVVFDHCSEFSVNITEDFIEYLSEGALAIEVYGHKMNDPR
KNPALWDLGIIQAKTRSLRDRWSEVTRKLEFWVQILEQNENGEYCPVEVIAAKDVPTGGI
FQLRQGQSRRVQVEVKSVQESGTLPLMEECILSVGIGCVKVRPLRSPKTHENIHEEEEDM
DSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKHDKTEDDADREAQLLEMRLTLTEE
RNAVMVPSAGSGIPGAPAEWTPVPGMEAHIPVVFLDLNADDFSSQDNLDDPEAGWDATLT
GEEEEEFFELQIVKHHDGEVKAEASWDSAVHNCPQLSKGTPADERVFLILRVAVQLSHPA
DMQLVLRKRICVHVHGRQGFAQSLLKKMTHRSSIPGCGVTFEIVSNIPEVDAQGVEEREA
LARMAANVENAASADSEACIEKYLRSVLAVENLLTLDRLRQEVAVKEQLTGKGKLNRRSI
SSPSMNRLSGSRQELSPSHSLSSNKPVPRILVQPTFSDARATRTEEAQQGSPGPSGALES
MVKMAAPTVKICDKPVRVSSPPSTMVVTQPQEGQDGPPSPLSEASSGYFSHSVSTATLSE
TLTLGLDTTGLGSQTPGSPPALCQVTQEPELAFLSCTQSHPTDPEEPHIPPATPTQSTEL
EVPRPPLLSDPTPAVPTSPFRIRKVRPSELTSFTGMLGGASSGAQEDPVVSEDPSHARGQ
TLGRLEVTSDSEDASEVPEWLREGEYVVVGTNKTGIVRYIGPTDFQEGTWIGVELDLPAG
KNDGSIGGKQYFRCNPGYGLLVRPGRVRRAAGTGRRRSSGLQPQGAPEARRSATISGSAT
NLASLTAALAKGDRSYKNPENRKSWAS
NT seq 5304 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactccaaagtgaaagtggcggtacgggtccggccaatgaaccgacgagaaatt
gacttacataccaaatgtgtggtggatgttgaagcaaacaaagttattttgaatcctata
aatacaaatctttccaaaggagatgcccggggccagccaaagatatttgcctatgatcat
tgtttctggtccatggatgagtctgtccgagagaagtatgcaggtcaagatgatgttttc
aagtgccttggggagaacattcttcagaatgcatttgatggctacaatgcctgtatcttt
gcctatgggcagacagggtctggaaaatcttacactatgatgggaacagccgaccaaccg
gggttaatcccacgtctctgcagtggactctttgaacgaacccagaaagaagagaatgaa
gaacagagttttaaagtcgaagtgtcgtacatggaaatttataatgaaaaagtccgagac
cttcttgaccccaaaggaagccgacaaacgttgaaagtgagagagcacagtgtgttggga
ccctacgtggatggactttctaaactggctgtcacaagctacaaggatatagagtctctg
atgtctgagggcaacaagtctcggacagttgctgcaaccaacatgaatgaagaaagtagc
cgttcccatgcagtcttcaaaattaccctgacacatactctgtatgatgtgaagtctggg
acatctggagagaaagtgggcaagctgagcttagtggatttagctggcagtgaacgagcc
acgaaaactggagctgcgggcgacaggctgaaggagggcagcaacatcaacaagtccctc
acaaccctgggtctggttatctctgccctagccgatcagggtgctggcaaaaacaaaaat
aaatttgttccctatcgagactcagttctcacatggctgctcaaggacagtctgggaggt
aatagcaagaccgccatggtggccactgtgagcccagctgctgataactatgatgaaaca
ctttcaaccctgaggtatgcagatcgagcaaagcacatcatcaaccatgctgtggtgaat
gaggatcctaatgctcggattatccgagatctccgtgaagaggtggagaagctccgtgag
cagctgactaaggcagaggcaatgaaatctccagagctgaaagatcgcctggaagaatct
gagaaactcatccaggaaatgactgtgacctgggaggagaaactaaggaaaaccgaggag
attgcgcaggagcggcagaagcagcttgagagccttggcatatctcttcagacttctgga
atcaaagttggggatgacaaatgcttcctggttaacttgaatgcggacccagctctgaat
gaactcctggtgtactacttaaaggagcacacgctgatagggtcagccaattctcaggac
atccagctctgtgggatgggcattctccctgagcatggtatcatagacatcatgcccgaa
ggccaggtcatgctgactcctcagaagaataccagaacatttgtcaatgggtcttctgtc
tccagccctatccagctacaccatggggacaggatactatggggaaacaaccatttcttc
agactcaatctgccaaaaaagaaaaagaaagcagagcgagaggacgaggagcgtgaggca
tctctgaaaaatgacagcagttctgagcagctggatgccgacggcgactcctccagtgag
gtgtccagcgaaatcaacttcaactttgagtatgcacagatggaggtgaccatgaaggct
ctgggcagcaatgacccaatgcagtccatattgagcagcctagaacagcagcatgaggag
gagaagcggtctgctctcgagcgccagaggctcatgtacgaacacgaactggaacagctc
cgaagaaggctgtctccggagaggcagaattgtcgaggtgtggaccggctttccttccat
tcacccagtgcccagcagcgcttgagacagtgggctgaggagagagaagcaacattgaat
aacagcttgatgaggctgagggagcagattgtaaaggccaacctgctggtacgggaagct
agttacatcgcagaggagctggataagagaaccgagtataaagttaccctccagattcca
gcctccagtctggatgccaataggaagcgaggctctctcctcagtgaacctgccatccag
gtgagaagaaaagggaaagggaagcagatttggtctttggaaaagctggaaaacaggctt
ttggatatgagagacctctaccaggagtggaaagaatgtgaagaagacagcccggtttcc
cgatcctacttcaagcgtgctgacccattctatgatgagcaggaaaatcatagtctcatc
ggtgtggccaatgtcttcctggagaccctgttttatgatgtgaagttacaatatgctgtg
ccgatcatcaaccagaagggagaggtggcaggccggctgcatgtggaggtgatgcggctc
agtggggccattggggagaggattgcaggaggagacgatcctacagaggtcagctctgag
aaggaagtccaggagaacaggctggtctgcatggttaaaatactccaggccacagggttg
cctcagcatctgtgccactttgtcttctgcaaatatgacttctgggatcagcaggagcca
gtgaccgttgctcccgaagtggacacctcttcatctcccaccagcaaggagccacagtgt
atggttgtgttcgatcattgcagcgagttcagtgttaacatcacagaagactttattgaa
tatctctcagaaggggccctggccattgaagtgtatggacataaaatgaatgatccccgg
aaaaacccagccctgtgggatttgggaatcatccaagcaaaaacaaggagtcttcgggac
aggtggagtgaagtcaccagaaagttggaattctgggttcagatcttggaacagaatgag
aatggcgaatactgccctgtggaagtaattgctgcaaaagatgtcccaacaggggggatc
ttccagctccgacaggggcagtctcggcgagttcaagttgaagtgaagtcagtgcaggag
tcagggactttgccactgatggaagagtgcatattgtcggttggcattggctgtgtgaaa
gttagaccgctcaggtcccctaagacccacgagaacatccatgaggaagaggaggacatg
gacagctaccaggatagggatttagagcggcttcgtagaaaatggctcaatgcattaacc
aaacgtcaagaatacttggatcaacaactgcagaagcttgtcagtaaacatgacaaaact
gaggatgatgctgaccgagaggcacagctcttggagatgcggctgacactcacagaggaa
agaaatgcggtgatggtgccgtctgctgggagtggcattccgggggcaccggcagaatgg
accccagtgcctgggatggaggcccacattcctgttgtatttcttgacttaaatgcggat
gatttcagctctcaggataaccttgatgacccagaggccggatgggatgctaccctgact
ggggaagaggaggaagagttctttgagttgcagattgtgaagcatcacgatggagaggtg
aaggcagaggcctcctgggactctgcagtgcacaactgtcctcagctcagtaaaggcaca
cctgctgacgagcgagtgttcctcatcctgagagtggcagtccagctcagccaccctgca
gacatgcaactggtcctacgcaagaggatttgtgtccatgttcatgggcgccagggcttt
gctcaaagtctcctcaaaaagatgactcatcggagctctatccctggctgtggagtgacc
tttgaaattgtctccaatattccagaggtggatgcccagggagtggaggagcgagaggca
ctggcaaggatggctgctaacgtggaaaacgcagcttctgctgactccgaggcctgtatt
gagaagtacttgaggagtgtgctggctgtggaaaacctcctgaccctagatcgcctgcgt
caggaagtggccgtgaaggagcagctgacaggaaaagggaagctgaaccggaggagtatc
agctctcctagcatgaacagattgtcaggaagccgacaggagcttagcccatcccacagt
ctaagcagcaacaagcccgtgccccgaatcttggtgcagcctactttctcagatgcccgg
gcaacaaggacagaggaggctcagcagggcagccctgggcctagtggggctttggagtct
atggtgaagatggcggcccctacagtaaagatctgcgacaaacctgtcagagtgtcttcc
cctccatctaccatggtagttactcagccccaagaagggcaggatggacctcccagcccc
ttgagcgaagcttcaagtggctacttctctcacagtgtctccactgccaccctgtcagaa
acgctcaccttaggcctggacaccacaggcctcggcagccagacacctggatccccccct
gccctgtgtcaggtcacccaagagcctgagctggctttcctctcctgcacacagagccat
ccaactgacccagaggagccccatataccacctgcaactcctactcaaagcacagagctg
gaggtccccagaccgcctctcctttctgaccccacacctgctgtgcccacgtctccattc
agaatccggaaagtgcggccctcagagcttacatccttcacaggcatgctggggggagcc
tcctctggagcacaggaggacccagtggtttcagaagacccgagccatgctaggggacag
actctagggaggctagaagtgacatctgactctgaggatgccagcgaagttcctgagtgg
ctcagagagggagagtatgttgttgtgggcaccaacaagacgggcattgtaagatatatt
ggaccaactgatttccaggagggaacgtggattggtgtggagctggacctgcctgcagga
aagaatgatggctccattggtgggaaacagtatttcagatgcaaccctggttacgggctg
ctggtgaggccaggccgggtccgcagggctgcaggcactgggcgcaggcgcagttcaggg
ctccagcctcagggagccccagaggcccgcaggagtgctactatctcgggctctgccacc
aacctggcttcactgacagctgcattggccaagggagacaggagctacaagaatcctgag
aaccggaagtcctgggccagctag

DBGET integrated database retrieval system