KEGG   Rattus norvegicus (rat): 306009Help
Entry
306009            CDS       T01003                                 

Gene name
Slc39a14
Definition
(RefSeq) solute carrier family 39 member 14
  KO
K14720  solute carrier family 39 (zinc transporter), member 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    306009 (Slc39a14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    306009 (Slc39a14)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   306009 (Slc39a14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zip Claudin_2 DUF808
Motif
Other DBs
NCBI-GeneID: 306009
NCBI-ProteinID: NP_001100745
RGD: 1307026
Ensembl: ENSRNOG00000009832
UniProt: D3ZZM0
Position
15p11
AA seq 490 aa AA seqDB search
MVTMERLHPAFPSYLLLVLFGIWRTVPQIHASSTGLLPLSATSFLEELMKRYGENDSLTL
PQLKTLLNSVGVGRDNVSLPKEAHRNLSTCFSSGDLFAAHNFSERSRIGKSEFQEFCPTI
LQQLDSRACTPENQENKENEQTEEGKPSAIEVWGFGFLSVSLINLASLLGVLVLPCTEKA
FFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNPQDNYVSKSAVVFGGFYLFFFTEKILK
MLLKQKNEHHHGHNHFTSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNNDLDGKAPSTD
EKVIVGSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVS
VFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYVGLAFGILAGSH
FSANWIFALAGGMFLYIALADMFPEMNEVCQEDEKKDSFLVPFVIQNLGLLTGFSIMLVL
TMYSGQIQIG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccatggagcggctacacccagccttccctagctacctcctgttggtgctgttt
ggtatatggagaactgtcccccagattcatgcctcatctactggcctgctgcccctcagt
gccacctctttcctggaagagcttatgaaacgctacggagagaatgacagccttaccttg
ccacagctgaagactctgctcaacagcgtgggcgtgggccgggataatgtttccctgccc
aaagaagcacacaggaacctctccacgtgctttagctctggagatctctttgcggcccac
aacttcagtgagcgatctcgtattgggaagagtgaattccaggagttctgccccaccatt
ctccagcagttggattcccgggcttgcaccccagaaaaccaggagaataaggaaaatgag
cagacagaggaggggaagccaagcgccattgaagtgtggggctttgggttcctcagtgtc
tcactgattaacctggcctcgctcctgggagtcctggtcctgccatgcacggagaaagcg
tttttcagccgtgtgctcacttacttcatcgccttgtccattggaacgctgctctctaac
gcacttttccagctcatcccagaggcttttggtttcaaccctcaggacaattatgtctcc
aagtctgctgtggtctttgggggtttctaccttttctttttcacagaaaagatcctgaag
atgctcctgaagcagaaaaacgagcaccatcacggacataaccattttacctccgaaacg
cttccttccaagaaggaccaggaggagggtgtcacggagaagctacagaatggggacctg
gatcatatgattcctcagcactgcaacaatgatctggatggcaaggcacccagcacagac
gagaaggtcatcgtaggctccatgtctgtgcaggacctgcaggcatcccagagtgcttgc
tactggctcaaaggggttcgatattctgatattggtaccttggcctggatgatcaccctg
agcgatggtctccacaatttcatcgatggcctggctatcggtgcctccttcactgtgtct
gtcttccaaggcattagcacgtcggtggccattctctgtgaggaatttcctcacgagctg
ggagacttcgttatcctgctcaatgctggtatgagtatccagcaggccctcttcttcaac
ttcctctctgcttgctgctgctatgtgggtctggcctttggtatcctggctggcagtcac
ttctctgcaaactggatttttgcactggctggaggaatgttcttgtatattgctctagcc
gatatgttccctgagatgaatgaggtgtgccaggaggatgagaagaaggacagctttttg
gtccccttcgtcatccagaatcttggcctcctaactggcttctccatcatgctggttctc
accatgtattcagggcagattcagatcgggtag

DBGET integrated database retrieval system