KEGG   Rattus norvegicus (rat): 306011Help
Entry
306011            CDS       T01003                                 

Gene name
Piwil2
Definition
(RefSeq) piwi-like RNA-mediated gene silencing 2
  KO
K02156  aubergine
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306011 (Piwil2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    306011 (Piwil2)
   piRNA pathway
    306011 (Piwil2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi PAZ ArgoL1
Motif
Other DBs
NCBI-GeneID: 306011
NCBI-ProteinID: NP_001100746
RGD: 1306964
Ensembl: ENSRNOG00000009871
UniProt: D3ZRE1
Position
15p11
AA seq 971 aa AA seqDB search
MDPVRPLFRGPTPVHPSQCVRMPGCWPQAPRPLEPAWGRAGPAGRGLVFRKPEESSPPLQ
PVQKESVGLVSMFRGMGLDTALRAPSKREVPPLGRGVLGRGLSANVVRKDREESRSSLPD
PSVLAAGDSKLAEASVGWSRMLGRGSSDVSLLPLGRAAGSIGRGVDKPPSAFGLTARDPP
RLPQPPTLSPTSLHSSDPPPVLTIERKEKELLVKQGSKGTPQSLGLNLIKIQCHNEAVYQ
YHVTFSPNVECKSMRFGMLKDHQSVTGNVTAFDGSILYLPVKLQQLVELKSQRKTDDAEI
SIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPG
YAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRY
NNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQNN
HGTLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHSALECLLQRISQN
ETANNELTRWGLSLQKDVHKIEGRLLPMERINLRNTSFVTSEDLNWVKEVTRDASILTIP
MHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGV
EGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMN
CKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQ
EIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFDN
YHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGI
PTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
AIQLCENLFFL
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgtccggccattgttcagggggcctactccagtccacccatctcaatgtgtt
cggatgccaggctgttggccgcaagctcctagacctttggaaccagcttggggtagggca
ggacctgcaggcagaggccttgtgtttagaaagccagaggaatccagcccaccactccag
ccagtacaaaaggagtctgtgggtttggtgtccatgtttcgtggcatgggtcttgacaca
gcattgcgggccccttcaaaacgagaagtgcctcctttaggcagaggagttctaggtcga
ggcttgtctgctaacgtagtccgcaaggacagagaagaatcccgttcctctttgcctgat
ccttcggtgctggcagctggggacagcaagctggcagaggcttctgttggatggagtaga
atgctgggaagaggtagttctgatgtctctttgttaccactgggaagagcagctggtagt
ataggcagaggagtggacaaacctcccagtgcctttggccttactgctcgggatccccct
cggctgccccagcctccaactctgtctccaacttcactgcactcctctgatcctcctcca
gtcctgactatagagcgaaaggaaaaagagcttttggtcaagcaaggatcaaaaggaaca
cctcagtctttaggactgaacctcatcaaaatccagtgtcataacgaagcagtttatcaa
tatcatgtaactttcagccccaatgtggagtgcaaaagcatgaggtttggcatgttgaag
gaccaccaatctgtcactggaaacgttactgcttttgatggctctattctttatcttcct
gttaagcttcaacaacttgttgagttaaaaagccagagaaaaactgatgatgccgagatc
agcatcaagattcagctgacaaagatcctggagccatgttccgacttgtgcattcccttc
tacaatgttgtcttccggcgggtaatgaaacttttggatatgaagcttgtggggagaaac
ttctatgatcctacaagtgccatggtactgcagcaacacagattgcagatctggcctggc
tatgcagctagtatccggaggacagatgggggtctcttcttgctcgctgatgtctctcat
aaggtcattcggaatgactctgtactggatgtcatgcatgctatctaccagcagaacaag
gagcacttccaggacgagtgcagcaagcttctggtgggcagcattgtcatcacacgctac
aacaaccgtacctaccgcattgacgatgtggactggaacaagacccctaaagacagcttt
gtaatgtcggatgggaaggagatcacattcctggagtactacagtaaaaactatgggatc
acagttaaagaagatgaccagccgctgctcatccaccggcccagtgagagacagaataac
catggcacgttgctgaagggtgagatcctgctgctgcctgagctttccttcatgacgggg
attcctgagaagatgaagaaggacttcagggccatgaaggacttgactcagcagattaac
ctgagccccaagcagcaccacagtgctttggaatgcctgctgcagagaatttcacaaaat
gagacagccaacaacgagctgacccgctgggggctcagtctgcaaaaagatgtccacaag
atcgaaggccgtcttctaccaatggagaggattaacttaaggaatacttcatttgtcaca
tcggaggacctgaactgggttaaggaggtgaccagagatgcttccattctgactattccc
atgcatttctgggcactcttttatccaaagagagcaatggaccaagccagagaactggtt
aacatgttggaaaagattgctggccccattggcatgcgcataagccccccagcctgggtt
gaactgaaggatgaccgaatagagacctatatcaggaccattcagtccttactgggagtt
gaggggaagatacaaatggtcgtttgcatcatcatgggcacacgggatgatctctatggg
gccatcaagaaactgtgctgtgtgcagtccccagtgccctcacaggtcatcaatgtccga
accattggtcaacccaccaggcttcggagtgtggctcagaaaattttacttcagatgaac
tgtaaactgggtggtgagctctggggagtagatattccactgaaacaattaatggtgatt
gggatggatgtgtaccacgaccccagcagaggcatgcgctctgtggttggctttgttgcc
agcataaatctcacactcaccaaatggtactcgagggtggtgttccagatgccgcatcag
gagattgtggacagcctgaagctctgcctggtgggctccttgaaaaagtattatgaggtg
aaccactgtctcccagagaagattgtggtgtaccgagatggagtgtctgatggccagcta
aagacagttgccaactatgagatccctcagctgcagaagtgctttgaagcctttgataac
taccatcccaagatggtggtatttgtagttcagaagaaaatcagcaccaatctgtacctt
gctgctcctgaccactttgtgaccccctcccctgggactgtggttgatcataccataacc
agctgtgagtgggtggatttctaccttcttgctcatcatgtgcgacagggctgtggcata
cctacacactacatctgtgttctgaacactgcaaatctgagccctgatcacatgcagagg
ctgactttcaaactatgccacatgtactggaattggcctggtaccatccgagttccagct
ccttgcaagtatgcccacaagctagctttcctgtccggacagattttgcatcatgaacca
gccatccagctatgtgagaacctgttcttcctgtaa

DBGET integrated database retrieval system