KEGG   Rattus norvegicus (rat): 306012
Entry
306012            CDS       T01003                                 

Gene name
Polr3d
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC4
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    306012 (Polr3d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    306012 (Polr3d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    306012 (Polr3d)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     306012 (Polr3d)
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 306012
NCBI-ProteinID: NP_001026823
RGD: 1311816
Ensembl: ENSRNOG00000010028
UniProt: Q4FZS9
Position
15
AA seq 398 aa
MSEGNAAGEPSNPGGPRPLLSGGRGLVGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQL
PLAHSGWLFKEESEEPDVKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAAR
KTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVV
IKQEKDRETRLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcggaaggaaacgccgcgggcgagcccagcaatcctggagggccccgaccccttctc
tctgggggccggggacttgtgggccggcggcccgctcccccgcttacgccaggccgcctt
ccctccatccgctctcgggacctcacccttggcggtgtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaagaagagccaaaggaagaagtaactatgaagaaggaa
aagcgtgaacgggacagagaccgccagcgtgagggtcatggacggggacgtggccgccca
gaagtgatccagtcccattccatctttgagcagggtccagcagaaatgatgaaaaaaaaa
gggaactgggataagactgtggatatgtcagacatggggccttctcatatcatcaacatc
aaaaaagagaagagagaaacagatgaagaaaccaagcagatcttgcgcatgctggagaag
gatgatttcatcgatgacccagggctaaagaatgacacacggaacatgccagtacaactg
ccactggctcattcagggtggcttttcaaggaggagagtgaagagccagacgttaagcct
ttttctgctggccccaaggaagaagacatggaggtggatgtgccagctgtaaaagtgaaa
gaggagccacgggatgaggaagaggaggcgaaagtgaaagcccctccaagagcagccagg
aagacccctggtcttccaaaggacgtgtctgtggcagagctgctgagggagttgagcctc
acgaaggaggaggagctgctgttccttcagctgcctgataccctccctgggcagccgcct
actcaggacatcaagcctgtcaagacagaggtgcagggcgaggatggacagatggtagtc
ataaagcaagaaaaggaccgggaaaccaggctagcagagaatgcttgtaccttggctgac
ctgacagagggtcaagtgggcaagctactcatccgcaaatcagggaaggtgcagcttctc
ctgggcaaggtgactctggatgtgaccatgggaacaacctgttctttcctgcaggaactg
gtgtctgtgggccttggggacagcaggacaggggagatgacagtcctaggacatgtgaag
cacaaacttgtatgttctcctgattttgaatctctcttggatcacaaacaccggtga

DBGET integrated database retrieval system