KEGG   Rattus norvegicus (rat): 306071
Entry
306071            CDS       T01003                                 

Gene name
Lcp1
Definition
(RefSeq) lymphocyte cytosolic protein 1
  KO
K17276  plastin-2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    306071 (Lcp1)
   04147 Exosome [BR:rno04147]
    306071 (Lcp1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     306071 (Lcp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   306071 (Lcp1)
SSDB
Motif
Pfam: CH EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 CAMSAP_CH
Other DBs
NCBI-GeneID: 306071
NCBI-ProteinID: NP_001012044
RGD: 1308288
Ensembl: ENSRNOG00000010319
UniProt: Q5XI38
Position
15q11
AA seq 627 aa
MARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMAT
GDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMVNLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTKITNFSTDIKDSKAYY
HLLEQVAPRGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPGVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNRPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG
QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSITS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggccagaggatccgtgtctgatgaagaaatgatggagctcagagaggcttttgccaaa
gtcgatactgacggcaacgggtacatcagctgcaatgaactgaatgacttgttcaaggcg
gcctgcctgcctctgcctggctaccgagtgagagaaatcacagagaacctgatggccaca
ggtgacctggaccaagatgggaagattagctttgatgagtttatcaaggtcttccatggc
ttaaaaagcaccgaggttgccaaaaccttccgaaaagctatcaacaagaaggaagggatc
tgtgcgatcggtggcacctctgagcagtccagcgtgggtacccagcattcctactcagag
gaagaaaagtatgcctttgtcaactggataaacaaagccctggagaatgaccctgactgc
cggcacgtcatccccatgaacccgaacaccgatgatctcttcaatgctgtcggggatggc
atagttctttgtaaaatggtcaacctgtctgtgccagacacaattgatgaaagaacaatc
aacaagaagaagctcacaccgttcaccattcaggaaaacttgaacttagctctgaactct
gcctcggccatcggatgccatgtagttaatataggggctgaggacctgaaggaggggaag
ccatatctggtcctgggacttttgtggcaagttatcaagattgggttgtttgctgacatt
gaactcagcagaaatgaagctctgattgctcttttgagagaaggagagagcctagaggat
ttgatgaagttgtctcctgaagaactcctgttgcggtgggcgaactaccacctagaaaat
gcaggctgcaccaaaatcaccaacttcagcactgacatcaaggactcgaaagcttattac
cacctgctcgagcaggtggctccgagaggagatgaagaagggatcccggctgtagtgatt
gacatgtcaggactgagggagaaggatgacatccagagagcagagtgtatgttgcagcag
gcagagaggctgggctgccggcagtttgtcacagccactgatgttgtccgagggaacccc
aagttgaacctggccttcattgccaacctctttaacaaataccctgccttgcacaaaccg
gagaaccaggacattgactggggggctctcgaaggtgagacgagggaagagcggacgttc
aggaactggatgaactcactgggagttaaccctggagtcaatcatttgtacagcgactta
tccgacgccctggtcatcttccagctctatgaaaagatcaaagtccctgttgactggaac
agagtaaacagacctccataccccaagctggggggcaacatgaaaaagctcgagaactgt
aattatgcagtggatctggggaagaatcaagctaaattttccctagttggtatcgcagga
caagacctcaatgaaggaaaccgcactctgacgctggcattggtttggcagctcatgaga
aggtacacactgaatatcctggaagatattggaggtggtcagaaggtcaatgatgacatt
attgtcaactgggtgaacacgacattgaaggaggcacagaaaagttcgtccatcactagc
ttcaaggacccaaagatcagcaccagcctcccggttctggatctcatcgatgccattcag
ccaggctccataaactatgaccttctgaagacagaaaacctggatgatgaagagaagctc
aacaatgcaaagtatgctatctccatggccagaaaaatcggagcaagagtgtatgccctt
ccagaagacctggttgaagtgaaccccaaaatggtcatgacagtgttcgcttgcctcatg
gggaaagggatgaagagggtgtaa

DBGET integrated database retrieval system