KEGG   Rattus norvegicus (rat): 306081Help
Entry
306081            CDS       T01003                                 

Gene name
Pcdh20
Definition
(RefSeq) protocadherin 20
  KO
K16498  protocadherin delta 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    306081 (Pcdh20)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    306081 (Pcdh20)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     306081 (Pcdh20)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Protocadherins
   306081 (Pcdh20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2
Motif
Other DBs
NCBI-GeneID: 306081
NCBI-ProteinID: NP_001100750
RGD: 1306297
Ensembl: ENSRNOG00000013306
UniProt: D4ADD1
Position
15q12
AA seq 952 aa AA seqDB search
MRGQGNARSSLVQAVSLRPATWHPCLDMGHLHRPSSRTSHRNLPHVVLLFLFVGPFNCLA
SYSRATELLYSLNEGLPAGVLIGSLAEDLRLLPRASGRQSQQLLHPERTAAEGNPPLSFS
LASGGLSGQYVTLDNRSGELHTSAQEIDREALCLDGGGGAAWGGSTSIASSPSSDSCLLL
LDVLVLPQEYFRFVKVKIAIRDINDNAPQFPISEISVWVPENSPVNTRLAIEHPAVDPDV
GINGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDRETQDQYVSIIIAEDGGSPP
LLGSATLTIGISDINDNCPLFIDSQINVTVYGNATVGTPVTTVQAVDRDLGTNAQITYSY
SQKVPQESKELFHLDEVTGVVKLSSKIGGNVLQTHKLTILANGPGCIPAVITALVSIIKV
VFRPPEIVPRYIANEMDGVVYLKELEPVNTPIAFFTIRDPEGKYKINCYLEGEGPFRLAP
YKPYNNEYLLETTKPMDYELQPFYEIAVVAWNSEGFHDKRIIKVQLLDDNDNAPVFLQPL
IELTIEENNAPNAFLTKLYATDADSGEMGRVSYFLGPDAPSYFSLDSVTGILTVSTQLDR
EEKEKYRYTVRAVDCGKPPRESVATVALTVLDKNDNSPRFINKDFSFFVPENFPGYGEIG
VISVTDADAGRNGWVALSVMNQSDIFVIDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGE
PALSSTTKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAV
IAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMV
NLFVNDTVSNESYIESLLRKEPEINIEEKEPQISIKPTHRKVESMSCMPTLVALSVISLA
SITLVTGMGIYICLRKGKKHHREDDNLEVQIPLKGRIDLCMRERKPMDISNI
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccaagggaacgcgcgcagctcgctggtccaggcagtgagcttgcgcccagcg
acctggcacccgtgcctggatatggggcatctacatcgtcccagcagcaggaccagccac
aggaacctgccgcatgttgttctgcttttcctcttcgtgggacccttcaactgcctcgcg
agttacagtcgtgctaccgagcttctgtacagcctaaacgaaggactgcccgcgggagtg
ctcataggcagcttggcggaggacctgaggttgctgcctcgggcctctgggagacagagc
cagcagttgctgcatccagagcgcactgctgctgaggggaacccccctctctctttcagc
ttggcctccgggggactgagtggccagtatgtgaccctagacaaccgctccggggagctg
cacacttctgcacaggagatcgacagagaagcattgtgcttggatggtggtggaggggct
gcctggggcggcagtacctccattgcctcctctccttcttctgattcttgccttttgctt
ctggatgtgctggtcctgcctcaggaatattttaggtttgtgaaggtgaaaattgccatc
agggatatcaatgacaatgctccgcagttccccatttctgaaatctctgtttgggtcccg
gaaaattcacctgtaaatacccgattggcgatagagcatcctgctgtggacccggatgta
ggcattaatggtgtgcaaacctatcgcttactggactaccatggtatgtttaccctagac
gtggaggagaatgagaatggggaacgcacaccctacttgattgtcatgggcgctttggac
agagaaacccaggaccagtatgtgagcatcatcatagctgaggatggtgggtctccgcca
ttgctgggcagcgccaccctcaccattggcataagtgacattaatgacaattgtcctctc
ttcatagactcacaaattaatgtcaccgtttatggaaatgctacagtgggcacccctgtc
acaacagtccaggctgtggatagagacttggggacaaacgcacagatcacttacagttac
agtcagaaagttccacaagaatccaaggaattattccacctggatgaagttactggagtc
gttaagctttccagtaagatcggtgggaatgttctacagacacataagctcaccatcctc
gctaacggacctggctgtattcccgcagtgatcactgctctcgtgtcgatcatcaaagtc
gttttcagacccccagaaattgtcccacgttatatcgcaaatgagatggatggtgtcgtg
tatctgaaagaattggagcctgttaatactccaatcgcgttttttaccatcagagatccg
gaaggcaaatacaaaattaactgctacttggagggtgaagggccattcaggctagcaccc
tacaagccatacaacaatgaatacttgttggagaccacaaaacctatggactatgagctg
cagccgttctatgaaatagctgtagtggcctggaactcagaggggtttcatgacaagaga
atcattaaagtacaacttctagatgacaatgacaatgcccctgttttccttcagcccttg
atagaactgaccattgaagaaaacaatgcacccaatgcctttctgacgaagctctatgct
acagatgccgacagtggagagatgggccgagtttcctacttcttgggacccgatgctccg
tcctatttttccttagacagcgtcacagggattctgaccgtttccactcagctggacaga
gaagagaaagaaaagtacaggtacactgtccgagcagtggactgtgggaagccacccaga
gaatcagtggctacagtggctctcaccgtgttggataaaaatgacaacagtccgaggttc
atcaacaaagacttcagcttttttgtgccagaaaactttccgggatatggtgaaattgga
gtcattagtgtaacagatgctgatgctgggaggaatggatgggtagccctctcggtaatg
aaccagagtgatattttcgtcatagatacaggtaaaggcatgttgagagctaaagtctct
ttagacagagaacagcaaagctcatacactctgtgggtggaagctgttgatgggggtgag
cccgccctttcttctaccacaaaaatcacaattctccttctggacatcaatgataaccct
ccccttgttttgtttcctcaatctaatatgtcttacttgctggtcctaccttctactctc
cctggctcaccagtgacagaggtctatgcagttgacaaagatacaggcatgaatgcagtc
atagcttatagtatcatagggagaagaggtcccaggcctgagtccttcagaattgacccc
aagactggcaacatcactctggaggaagccttgctgcagacagattatggtttgcatcgc
ttactcgtgaaagtgagtgatcacggataccccgaacctctccattccacggtcatggtg
aacttatttgtcaatgacactgtcagtaacgagagctacattgagagccttttaaggaag
gaaccagaaattaatatagaagagaaagaaccacaaatctcaataaagccaactcatagg
aaggtagagtctatgtcctgtatgcccacattggtggctctgtctgtcataagcttggct
tccatcacactagttacagggatggggatatacatttgcttacggaaaggtaaaaaacat
cacagggaagacgacaatttggaagtacagattccattgaaaggaagaattgacttgtgt
atgagagagagaaaaccaatggacatttctaacatttga

DBGET integrated database retrieval system