KEGG   Rattus norvegicus (rat): 306127
Entry
306127            CDS       T01003                                 

Gene name
Acod1, Irg1, RGD1563454
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    306127 (Acod1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     306127 (Acod1)
SSDB
Motif
Pfam: MmgE_PrpD
Other DBs
NCBI-GeneID: 306127
NCBI-ProteinID: NP_001100752
RGD: 1563454
Ensembl: ENSRNOG00000009919
UniProt: D3ZWM1
Position
15q23
AA seq 488 aa
MMLKSVTESFASMIHGLRVGHLTDGVIQRSKRMILDSLGVGFLGTGTEVFHNVTQYSKIY
SSNTSSTVWGRPDFRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALSEALP
QTPKFSGLDLLLAFSVGIEVQGRLLHFSKEAKDIPKRFHPPSVVGTLGSAAATSKFLGLS
LTKCREALAIAVSHAGAPIANAATQTKPLHIGNAAKHGMEATFLAMLGLQGNKQILDLGS
GFGAFYANYSPKDLPSLDSHIWLLDQQDVAFKSFPAHLATHWVADAAAAVRKHLVTSERA
LLPADHIERIVLRIPDVQYVNRPFPDSEHEARHSFQYVACATLLDGSVTVPSFYSQKVNR
PQVKELLKKVELEHPPDNLPSFNTLYCEISITLKDGTTFTERSDTFYGHWRKPLSQEDLH
KKFRANASKILGEDTVESLITVVEKLEDLEDCAMLTRLLKGPSVQEEASKLSSIFSFHHT
SLPKFTNI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgatgctcaagtctgtcacagagagctttgccagtatgattcacggcttgagagtgggc
cacctgacagatggcgtcattcagaggagcaagaggatgatcctggactctctgggcgtt
ggtttcctgggaacaggcacggaagtgttccataacgtcacccaatatagtaaaatctac
agttccaacacctccagcactgtttggggtcgaccagacttcaggctccctcccacatat
gctgcttttgttaacggtgttgctattcactccatggattttgatgacacgtggcaccct
gccacccacccttccggggctgtcctacctgtgctcacagctttatcggaagccctgccc
cagacgccaaagttttctggcctcgacctgctgctggcgttcagcgttggtattgaagta
caaggacgattgttgcacttctccaaggaggccaaggacataccaaagaggttccatcct
ccctctgtggtggggactctgggaagtgctgctgccacatccaagtttttggggctcagc
ttaacaaagtgccgtgaggccttggctattgctgtttcccatgccggggcgcccatagca
aacgctgccactcagactaagccccttcatatcggcaatgcagccaagcatgggatggaa
gccacatttctggcaatgctgggcctccaaggaaacaaacagatcttggacctggggtca
gggtttggcgccttctatgccaactactcccccaaagaccttccaagcctggattctcac
atctggctcctagaccagcaggatgtggcctttaagagcttcccggcacatctggctacc
cactgggtggcagacgcagccgcagctgtgagaaagcacctcgtgacttcagaaagagcc
ctgcttcctgctgaccacatcgagagaatcgtgctcaggatccctgatgtccagtacgta
aacaggcccttcccggactcagagcatgaagcccgtcattccttccagtatgtggcctgt
gccacgctgctcgatggtagcgtcactgtcccatccttctatagccagaaggtcaacagg
cctcaggtgaaagagttgctcaagaaggtggagttggaacatcctcccgacaacctgcca
agcttcaacacgctctactgtgaaataagcatcactctaaaggatggaaccactttcacc
gagcgctctgacaccttctatggtcactggaggaaaccactgagccaggaggatctgcac
aagaagttccgtgccaatgcctcaaagattctaggcgaggacacagtagaaagccttata
acggtagtagaaaaactagaagacctagaagactgcgccatgctaaccagacttctgaaa
ggaccctctgtccaagaggaggcttccaaactatccagcatattctcattccatcacaca
agtttgcccaagtttaccaatatctaa

DBGET integrated database retrieval system