KEGG   Rattus norvegicus (rat): 306128
Entry
306128            CDS       T01003                                 

Gene name
Cln5
Definition
(RefSeq) ceroid-lipofuscinosis, neuronal 5 precursor
  KO
K12390  ceroid-lipofuscinosis neuronal protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    306128 (Cln5)
SSDB
Motif
Pfam: CLN5 NlpE_C
Other DBs
NCBI-GeneID: 306128
NCBI-ProteinID: NP_001178618
RGD: 1306965
Position
15
AA seq 341 aa
MPRVGPGGAHWRPALALALLGLAATLGASPTSGQRWPVPYKRFSFRPKTDPFCQAKYTFC
PTGSPIPVMKDNDVIEVLRLQAPVWEFKYGDLLGHFKIMHDAIGFRSTLTGKNYTVEWYE
LFQLGNCTFPHLRPEVNAPFWCNQGAACFFEGIYDKHWKENGTLSLVATVSGNTFNKVAE
WVKQDNETGIYYETWTVRASPGKGAQTWFESYDCSNFVLRTYEKLAEFGTDFKKIETNYT
KIFLYSGEPIYLGNETSIFGPKGNKTLALAIKKFYGPFKRYSSTKDFLLNFLKIFDTVIM
HREFYLFYNFEYWFLPMKPPFVKITYEETPLPTQHTTFTDL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgccgcgcgtggggccaggcggagcgcactggcgcccggcgctcgcgctggcgctgctg
gggctggcggccactctgggcgcgtccccgacgtctgggcaacgctggcccgtaccctac
aagcgcttctccttccgtccgaagacagatcccttctgtcaagccaagtatactttctgc
cctactggctcacccatcccagttatgaaggacaatgacgtcatcgaagtcttaaggcta
caagcccctgtttgggaatttaaatatggagacctcctgggacacttcaaaatcatgcac
gatgccattggattcaggagtacgctgacgggcaagaactacacagttgaatggtatgag
cttttccagctcggcaactgtacatttccccaccttcggcccgaagtgaacgctccgttc
tggtgtaaccagggggcagcctgcttctttgaaggaatttacgataaacactggaaggaa
aacgggacgttgtcgctggttgcaaccgtatccggaaacacgtttaacaaagtggccgag
tgggtgaagcaggacaatgagactgggatttattacgagacatggacagtccgggccagc
ccaggaaaaggggcgcagacatggtttgaatcctacgactgttcaaattttgtcttaagg
acatatgagaaattggctgaatttggaacagatttcaagaagatagaaacaaactatacg
aaaatatttctttacagcggagaaccgatttacttgggaaatgaaacgtctatttttggg
cccaaaggaaacaagacccttgctttggccataaaaaaattttacggccccttcaaacgg
tattcgtcaaccaaagattttctgttgaatttcttgaaaatttttgacacagtgattatg
cacagagagttctacctgttttataactttgagtattggtttctacctatgaaacccccc
tttgtcaaaataacgtacgaggaaacccctttacctacccaacatacgacatttaccgac
ctgtga

KEGG   Rattus norvegicus (rat): 310166
Entry
310166            CDS       T01003                                 

Gene name
RGD1564125
Definition
(RefSeq) ceroid-lipofuscinosis neuronal protein 5 homolog
  KO
K12390  ceroid-lipofuscinosis neuronal protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    310166 (RGD1564125)
SSDB
Motif
Pfam: CLN5
Other DBs
NCBI-GeneID: 310166
NCBI-ProteinID: XP_038959828
RGD: 1564125
Position
2
AA seq 495 aa
MDVGQQNVKGTLIPGQDKLNPWGTLRDARCIPSLPGSQAPLIIERPTPWPGSHRDFRESV
GPGGAHWRQALALALLGLAATLGASPTSGQRWPVPYKRFSFRPKTDPFCQAKYTFCPTGS
PIPVMKDNDVIEVLRLQAPVWEFKYGDLLGHFKIMHDAIGFRSTLTGKNYTIEWYELFQL
GNCTFPHLRPEVNAPFWCNQGAACFFEGIYDKHWKENGTLSLVATISGNTFNKVAEWVKQ
DNETGIYYETWTVRASPGKGAQTWFESYDCSNFVLRTYEKLAEFGTEFKKIETNYMKIFL
YSGEPIYLGNETSIFGPKGNKTLALAIKKFYGPVKRYSSTKDFLLNFLKIFDTVIMHREF
YLFYNFEYWFLPMKPPFVLEKKKETPLCQNNVRGNPFTYPTYDIYRLVTASLCCCYSPST
SIHILPGLCLHWCLWSPSPPGAPCRKYSICQDSRKEAETLIVLAKVNGLQLLDLSHGDSL
IPRLTCFLGPPFLLQ
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggatgtggggcagcagaatgtgaaaggtaccctgattcctggtcaagataagttgaat
ccctgggggaccttaagagatgccaggtgcattcccagtctcccaggaagtcaggcccct
ctcatcatagagaggccgacgccctggcccgggagccaccgggacttcagggagtccgtg
gggccaggtggagcgcactggcgccaggcgctcgcgctggcgctactggggctggcggcc
actctgggcgcgtccccgacgtctgggcaacgctggcccgtaccctacaagcgcttctcc
ttccgtccgaagacagatcccttctgtcaagccaagtatactttctgccctactggctca
cccatcccagttatgaaggacaatgacgtcatcgaagtcttaaggctacaagcccctgtt
tgggaatttaaatatggagacctcctgggacacttcaaaatcatgcacgatgccattgga
ttcaggagtacgctgaccggcaagaactacacaattgaatggtatgagcttttccagctc
ggcaactgtacatttccccaccttcggccggaagtgaacgctccgttctggtgtaaccag
ggggcagcctgcttctttgaaggaatttacgataaacactggaaggaaaacgggacgttg
tctctggttgcaaccatatccggaaacacgtttaacaaagtggccgagtgggtgaagcag
gacaatgagactgggatttattacgagacatggacagtccgggccagcccaggaaaaggg
gcgcagacatggtttgaatcctacgactgttcgaattttgtcttaaggacatatgagaaa
ttggctgaatttggaacagaattcaagaagatagaaacaaactatatgaaaatatttctt
tacagcggagaaccgatttacttgggaaatgaaacgtctatttttgggcccaaaggaaac
aagacccttgctttggccataaaaaaattttacggccccgtcaaacggtattcgtcaacc
aaagattttctgttgaatttcttgaaaatttttgacacagtgattatgcacagagagttc
tacctgttttataactttgagtattggtttctacctatgaaacccccctttgtcctggaa
aaaaaaaaagaaacccccctttgtcaaaataacgtacgaggaaacccctttacctacccg
acatacgatatttaccgacttgtgacagcctccctctgctgctgctactctccatccacc
agcatccatattctcccggggctgtgcctacactggtgtctttggtcaccttcacctcct
ggggcgccttgtcggaagtacagtatatgtcaagactcccggaaagaagcagaaacctta
attgtattggccaaagtgaatggattgcaattactcgatctcagccatggagattctttg
atcccaaggttaacatgttttctcgggccaccttttctgttacagtag

DBGET integrated database retrieval system