KEGG   Rattus norvegicus (rat): 306129
Entry
306129            CDS       T01003                                 

Gene name
Fbxl3
Definition
(RefSeq) F-box/LRR-repeat protein 3
  KO
K10269  F-box and leucine-rich repeat protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    306129 (Fbxl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    306129 (Fbxl3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     306129 (Fbxl3)
SSDB
Motif
Pfam: F-box-like F-box DUF4116 F-box_5
Other DBs
NCBI-GeneID: 306129
NCBI-ProteinID: NP_001094038
RGD: 1305660
Ensembl: ENSRNOG00000059334
UniProt: G3V9P4 Q562A1
Position
15
AA seq 428 aa
MKRGGRDSDQDSPEEGTAEKPKKPRTTHECSQPCDWGNLLQDIVLHVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaacgaggaggaagagatagtgaccaggactcacctgaggaaggcactgctgagaag
cctaagaaaccaaggacaacacatgagtgctcgcagccttgtgactggggtaaccttctt
caggacattgtcctccacgtttttaagtatttgcctcttcttgaccgggctcatgcttct
caagtgtgccggaattggaatcaggtatttcacatgcctgacttgtggcgatgttttgaa
tttgaactgaatcagccagctacatcttacttgaaagctacacatccagagctgatcaaa
cagattattaagaggcattcgaatcatctgcagtatgtcagcttcaaggtggacagcagc
aaagaatccgctgaagcagcttgtgatatattatcgcagcttgtgaattgctctttaaaa
acgcttggacttatttcaactgctcggccaagctttatggatctaccaaagtctcacttt
atctctgcactgacagttgtgtttgtaaactccaaatccctgtcctcacttaagatagac
gacaccccagtagatgacccatcccttaaagtcctagtggccaacaacagtgacacactc
aagctgctgaaaatgagcagctgtcctcatgtctctccagcagggattctgtgtgtggct
gatcagtgtcatggcttacgggagctggccctgaactaccatttgctcagtgatgagctg
ttgctcgcactgtcttctgaaaagcacgttcgcttagaacatttgcgcattgatgttgtc
agtgagaacccgggacagacacacttccacacgatccagaagagcagctgggacgccttc
atcaagcactcaccgaaggtcaacctagtgatgtattttttcctgtacgaagaggagttt
gacccgttcttccgttatgaaatccctgccactcatctttactttgggagatcagtcagc
aaagatgtgcttggccgcgtgggcatgacctgccccagactagtagaactggtagtgtgt
gccaatggcttgcggccccttgatgaagagttgattcgcattgcagaacgttgcaaaaat
ctgtcagctattgggctgggggagtgtgaggtctcatgtagtgcctttgtcgagtttgta
aagatgtgtgggggccgcctgtctcagttatccattatggaagaagtgttaattcctgac
cagaagtatagtttggaacagattcattgggaagtgtccaagcatcttggcagggtgtgg
tttccagacatgatgcctacgtggtaa

DBGET integrated database retrieval system