KEGG   Rattus norvegicus (rat): 306147Help
Entry
306147            CDS       T01003                                 

Gene name
Slitrk1
Definition
(RefSeq) SLIT and NTRK-like family, member 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 306147
NCBI-ProteinID: NP_001100753
RGD: 1308858
Ensembl: ENSRNOG00000009209
UniProt: D3Z8D8
Position
15q23
AA seq 696 aa AA seqDB search
MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQF
YHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKS
FRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPIT
HLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDLLSLKEWLENIPKNALIGRVV
CEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKINGQDEHAT
PGAVPNGGTKIPGNWQLKIKPTPPIATGSARNKPPVHGLPCPGGCSCDHIPGSGLKMNCN
NRNVSSLADLKPKLSNVQELFLRDNKIHSIRRSHFVDYKNLILLDLGNNNIANIENNTFK
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNN
NLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPF
KQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYAKISPTLTSHSKNSTGLA
ETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgctgctttggattctgttgctggagacgtctctttgttttgccgctggaaacgttaca
ggggacgtttgtaaagagaagatctgttcttgcaatgagatagaaggggacttacacgta
gactgtgaaaaaaagggctttacaagtctgcagcgcttcacggctccgacttcccagttt
tatcatttatttctgcatggcaattccctcactcgacttttccctaatgagttcgctaac
ttttataatgcggttagtttgcatatggaaaacaatggcttgcatgaaatcgttccgggg
gcatttctggggctgcagctggtgaaacgactgcatatcaacaacaacaagatcaagtct
tttcgaaagcagacttttttggggctggacgatctggaatacctccaggctgattttaat
ttattacgggatatagacccgggggccttccaggacttgaacaagttggaagtcctcatt
ttaaacgacaatctcatcagcaccctacctgctaatgtattccagtatgtgcccatcacc
cacctcgacctccgcggaaacaggctgaaaacactgccctatgaggaggtcttggagcag
attcctggcattgctgagatcctgttagaggataacccttgggactgcacctgtgatctg
ctctccctgaaggaatggctggagaacattcccaaaaacgccctaattggccgagtggtc
tgcgaagcccccaccaggctccagggtaaagacctcaatgaaaccacggaacaggacctg
tgtcctttaaaaaacagagtggattctagtctcccggctccccctgcccaggaagagacc
ttcgctcctggccccctgccaactcctttcaagataaatgggcaggacgaacatgctacc
ccaggggctgttccaaatggaggtacaaagatcccgggcaactggcaactcaaaatcaaa
cccacaccaccgatagcaactgggagcgccagaaacaaacccccagtgcatggcttgccc
tgccccgggggctgcagctgtgaccacatcccaggctcgggcttaaagatgaactgtaac
aaccggaacgtgagcagcttggctgatttgaagcctaagctttccaacgtgcaagagctc
ttccttcgagataacaagatccacagcatccgaagatcacactttgtggattacaagaac
ctcattctgttggatctgggcaacaacaacatcgcgaacatagagaacaacactttcaag
aaccttttggacctcagatggctgtacatggatagtaactacctggacactctgtcccgg
gagaaatttgctgggctgcagaacctggagtatctgaacgtggagtacaacgcgattcag
ctcattctacccggtactttcaatgccatgcccaaactgaggattcttattctcaacaac
aacttgctgaggtccctacccgtggacgtttttgctggggtctccctgtctaagctcagt
ctgcacaataattacttcatgtacctcccagtggcaggggtgctggaccagttaacctcc
atcatccagatagacctgcatggcaacccctgggagtgctcctgcaccattgtgcctttc
aagcaatgggcagagcgtctgggctccgaggtgctgatgagcgacctcaagtgtgagaca
ccggtgaacttctttaggaaggatttcatgctgctctccaatgacgagatctgcccccag
ctgtatgcgaagatctcgcccacgttaacttcgcacagtaaaaacagcactgggttggcg
gagaccgggacacactccaactcctacctagacaccagcagggtgtccatctccgtgttg
gtcccaggactgctgctggtgttcgtcacctccgccttcaccgtggtgggcatgctcgtg
tttatcctgaggaaccgaaagcggtccaagagaagggatgccaattcctctgcgtccgaa
attaattccctacagacagtctgtgactcttcttactggcacaatgggccttacaatgca
gatggggcccatagggtgtatgactgcggctctcactcactctcagactaa

DBGET integrated database retrieval system