KEGG   Rattus norvegicus (rat): 306152
Entry
306152            CDS       T01003                                 

Gene name
Slitrk5
Definition
(RefSeq) SLIT and NTRK-like family, member 5
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 GRP LRR_9 LRRNT
Other DBs
NCBI-GeneID: 306152
NCBI-ProteinID: NP_001100754
RGD: 1310957
Ensembl: ENSRNOG00000009649
UniProt: M0R9U3
Position
15q23
AA seq 958 aa
MHVCCPPVTLEQDLHRKMHSWMLHTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDI
ETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHMLQ
VLILNDNLLSGLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCS
CELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGP
SIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
ITVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLGNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNQLQAMPSGVFSGLTLLRLNLRSNSF
TSLPVSGVLDQLTSLIQIDLHDNPWDCTCEVVGMKLWIEQLKVGVLVDEVICKAPKKFAE
TYMRSIKSELLCPDYSDVVVSTPTPSSIQLPSRTNAAATPAVKLNSTGTPAGLGAGTGAS
SVPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGG
GGGGGGGHPHAHVHHRGSALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGNSVEDYKD
LHELKVTYSSNHHLQQQQPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP
REDLLSPVQDADRFYRGILEPDKHCSTTPAGSSLPEYPKFPCSPAAYTFSPNYDLRRPHQ
YLHPGAGESRLREPVLYSPPGAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgcacgtttgctgccccccagtaactttggaacaggaccttcacagaaaaatgcatagc
tggatgctgcacaccctagcatttgctgtaacatctctcgtcctctcctgtgcagaaacc
atcgattattatggggaaatctgtgacaatgcatgtccttgtgaggaaaaggacggcatt
ttaactgtgagctgtgaaaaccgagggatcatcagtctctctgaaattagccctccccgt
ttcccaatctatcacctcttattgtctggaaaccttctgaaccgcctctatcccaatgag
tttgttaattacactggggcttcaattttacatctgggtagcaatgttatccaagacatt
gagaccggggctttccatgggctgcggggtttgaggcgactgcatctaaacaataataaa
ttggaacttctgcgagacgatacctttcttggcttggagaacttagagtacctgcaggtc
gattacaattacatcagtgtcattgaacccaatgcttttgggaaactgcatatgctgcag
gtgcttatcctcaatgacaacctcttgtcaggtttacccaacaatcttttccgttttgtg
cccttaacgcacttggacttgcgggggaacaggctaaaacttctgccctatgtggggctg
ttgcaacacatggataaagttgtggaattacagctggaggaaaacccctggaattgctca
tgtgaactaatttctctcaaggattggttggacagcatctcctactcagcccttgtgggc
gatgtggtctgtgagacccccttccgtttacatggcagggatttggatgaggtatccaag
caggaactttgtccaaggaaacttatttctgactatgagatgaggccacagactccttta
agcaccacggggtatctacataccaccccagcttctgtaaactctgtggccacttcttcc
tctgctgtttacaaaccccctctgaagcctcccaaggggacccgccagcccaacaaaccc
agagtgcgccccacctctaggcagccctctaaagacttgggctacagtaactatggcccc
agcatagcctaccagaccaaatccccggtgcctttggagtgtcccacggcatgtacttgc
aacctgcagatctctgatctgggtctcaatgtcaactgtcaagagcgcaagatagagagc
atcgcagagctgcagcccaagccctacaatcccaagaaaatgtacctaacagagaactac
atcactgttgtgcgcagaacagacttcctggaagccactgggctagaccttctacacctg
gggaacaaccgcatctccatgatccaggaccgggcctttggggatctaggcaacctgaga
cgcctctatctgaatggcaacaggattgagaggctgagcccagagttattctatggcctg
cagagtctgcagtatctcttcctccagtacaatctcatccgtgagatccagtctgggact
tttgatccagtcccaaatctccagctgctattcttgaataacaaccaattgcaggccatg
ccttcaggtgtcttctccggcctgacacttctcaggctaaacctgaggagtaacagcttc
acctccttgccagtgagtggagttttggatcagctgacttccctcattcaaatagatctc
catgacaacccttgggattgtacctgtgaggtggtgggcatgaagctgtggattgagcag
ctcaaagtgggagtgttagtggacgaagtgatctgtaaggcgcccaagaaattcgcagag
acctacatgcgctccatcaagtctgagctgctatgtccagactattctgatgtggtggtt
tccacgcccacgccctcttccatccagttaccatcccggaccaacgcagcagcgacgccg
gctgtgaagttaaatagcactgggacccccgcaggcttaggtgctggtacgggggcttct
tcagtgcccttatctgtgttgattctcagtctgctgctggttttcatcatgtcggtcttt
gtggcagcaggccttttcgtgctggtcatgaaacgtaggaaaaagaaccagagcgaccac
accagtaccaacaactccgacgtgagctctttcaacatgcagtacagcgtctatgggggt
ggaggcggcggcgggggtggccacccacacgcacacgtgcaccatcgcgggtctgcgctg
cccaaggtgaagactcccgcgggccacgtgtatgaatacatccctcacccactgggccac
atgtgcaaaaaccccatctaccggtctcgagaaggcaattccgtggaggattacaaagac
ctgcacgagctcaaggtcacttacagcagcaaccaccacctgcagcagcagcagccgccg
ccgccgcaacagccccagcagcagccccctccgcagctgcagctgcagcctggggaggag
gagaggcgggaaagccaccacttgaggagccccgcctacagcgtcagcaccatcgagccc
cgagaggacctactgtcgccagtgcaggacgctgatcgcttttacaggggtattctagag
ccagacaaacactgctccactacccccgcaggcagcagcctcccggaataccctaaattc
ccatgcagcccggctgcttacactttctccccaaactatgacctgcggcgtccccatcag
tatttgcaccctggtgcaggggagagcaggctgcgggaaccggtgctctacagccccccg
ggtgctgtctttgtagaaccgaaccggaacgagtacctggagttaaaagcaaaactcaat
gttgagccggactacctcgaagtgctggaaaaacagaccacatttagtcagttctaa

DBGET integrated database retrieval system