KEGG   Rattus norvegicus (rat): 306243Help
Entry
306243            CDS       T01003                                 

Gene name
Cacna2d3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04921  Oxytocin signaling pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    306243 (Cacna2d3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    306243 (Cacna2d3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    306243 (Cacna2d3)
   04261 Adrenergic signaling in cardiomyocytes
    306243 (Cacna2d3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    306243 (Cacna2d3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    306243 (Cacna2d3)
   05414 Dilated cardiomyopathy (DCM)
    306243 (Cacna2d3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    306243 (Cacna2d3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   306243 (Cacna2d3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N dCache_1 VWA_3 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE Phage_holin_6_1
Motif
Other DBs
NCBI-GeneID: 306243
NCBI-ProteinID: NP_783185
RGD: 631361
Ensembl: ENSRNOG00000031287
UniProt: Q8CFG5
Position
16p16
AA seq 1085 aa AA seqDB search
MAGPGSLCCASRGASALLATALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIITYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNVLSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPERKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLADDQGLVLMTTVAMPVFSK
QNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEG
KKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYY
TDIKGAPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRH
LSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVA
FLGTRTGLSRINLFVGAEQLTNQDFLKARDKENIFNADHFPLWYRRAAEQIPGSFVYSIP
FSTGTVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCS
ISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAM
CRANKESSDSAHGLLDPYKAFLSAAKWIVTELVLFLVEFNLCSWWHSDMTAKAQKLKQTL
EPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPIT
MAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGASSLQAQVALLLLPLVS
SLFSR
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggctcgctgtgctgcgcgtcccggggggcctcggcgctcctagccaca
gcgcttctctacgccgcgctgggggacgtggtgcgctccgagcagcagatcccgctctcc
gtagtgaagctctgggcctccgcttttggtggggagataaaatccattgctgccaagtac
tcgggttcccagcttctgcaaaagaaatacaaagagtatgagaaagacgttgccattgaa
gaaatcgacggtctccaactggtgaaaaagctggccaagaacatggaagagatgtttcac
aagaagtccgaggcagtgcggcgtctcgtggaggctgcagaggaagcacacctgaagcat
gaatttgacgccgacttgcagtatgaatacttcaatgccgtgctgatcaacgagagagac
aaagatgggaactttttggaattgggaaaggagttcatcttggcccccaatgaccatttt
aataatttgcctgtgaacatcagtctgagtgatgtccaagtgccaacgaacatgtacaac
aaagatcctgccatagtcaatggagtgtattggtctgaatctctaaacaaagtttttgta
gacaacttcgatcgggacccgtctctcatatggcagtactttggaagtgcaaagggcttt
ttcagacagtacccagggattaaatgggaaccagacgagaatggagtcattgcctttgac
tgcaggaacaggaaatggtacatccaggcagcaacttctccaaaggatgtggtcattttg
gtggacgtcagcgggagcatgaaaggactccgcctgaccatcgccaagcaaacagtctcc
tcgatactggacaccctgggcgatgatgacttcttcaacatcatcacgtataacgaagag
cttcactatgtggaaccttgtctgaatggaacactggttcaagcggacaggaccaacaag
gagcacttcagggagcatttggacaaactttttgccaaagggattggaatgctcgatatt
gcgctgaacgaggccttcaatgtactgagcgatttcaaccacaccggacaaggaagcatt
tgcagccaggccattatgctcataaccgacggggcagtggacacctacgacaccatcttt
gcaaagtacaattggccagagcgaaaggttcgaatcttcacttacctcattggacgagag
gctgcttttgcagacaatctcaagtggatggcttgtgctaacaaaggatttttcacccag
atctccaccttggctgatgtgcaggaaaatgtcatggaatacctccatgtactcagtcga
cccaaagtcatcgaccaggaacatgatgtggtgtggaccgaagcgtacatcgacagcact
cttgctgatgatcagggcctcgtcttgatgaccacagtggccatgcctgtgtttagtaag
cagaacgaaactaggtcaaagggcattcttctgggtgtggttggcacagatgtcccagta
aaagagcttctgaagaccatccccaaatacaagttaggaattcatggttatgcctttgcc
atcacgaataatggatacatcttgacacacccggagctcaggcccctgtatgaagaaggg
aaaaagcgaaggaagcctaattacagtagtgtggatctctcggaagtcgagtgggaagat
cgggatgatgtgttacgaaatgccatggtgaatcggaagactgggaaattctccatggaa
gtgaagaagactgtggacaaagggaaacgggttttggtgatgaccaatgactactactac
acagacatcaagggtgctcctttcagtttaggtgtggcgctctccaggggccacgggaaa
tacttcttccgagggaatgtaaccattgaagaagggctccatgacttagaacatcctgac
gtgtccttggcagatgaatggtcctactgcaacactgatctgcacccagagcaccgccat
ctctctcaactggaagcgattaagctctacctcaaaggcaaggagcctctgcttcaatgt
gacaaagaattgattcaagaagtcctttttgatgctgtggtaagcgcccctatcgaagcc
tattggaccagcctggccctcaacaaatctgagaattctgacaagggtgtagaggtcgcc
ttcctcggcactcgcacaggcctctcaagaatcaacctgtttgtgggggctgaacagctc
accaatcaggactttctgaaggctagagacaaagagaacattttcaacgcagatcatttc
cctctctggtacagaagagctgccgagcagattccaggaagttttgtctactccatcccc
ttcagcacaggaacggtcaacaaaagcaatgtggtgacagcaagtacctccatccaactc
ctggatgagcgaaaatctcctgtggtggcagctgtaggcattcagatgaaacttgaattc
ttccaaaggaagttctggacggccagcagacagtgtgcctccctggatggtaaatgctcc
ataagctgcgacgatgagactgtgaactgttacctcatagacaataacgggttcattctg
gtgtctgaagactacacacagactggagatttttttggtgaggtcgaaggagctgtcatg
aacaagttgttaacaatgggctcctttaaaagaataaccttgtatgactaccaagccatg
tgtagagccaacaaggagagtagtgacagtgcccacggactcctggacccctataaggcc
ttcctctctgcagccaagtggatagtgacggaacttgtcttgttcctggtggagtttaac
ctttgcagttggtggcactctgacatgacagctaaagcccagaaactgaaacagaccctg
gagccttgtgatactgaatacccagcctttgtttccgaacgcaccatcaaggagaccaca
gggaacattgcttgtgaagactgctccaagtcctttgtcatccagcaaatcccaagtagc
aatctgttcatggtggtggtggacagtagctgtctctgtgagtctgtggctcctatcacc
atggcacccattgaaatcaggtataatgaatcccttaagtgtgaacggttaaaggctcag
aagatcagacgacgtccggaatcctgccacggcttccatcctgaggagaatgcgagagag
tgtgggggtgcatcaagtctccaggcccaggtggccttgctgctgctccccctggtttcg
agtctcttctcaaggtga

DBGET integrated database retrieval system