KEGG   Rattus norvegicus (rat): 306251
Entry
306251            CDS       T01003                                 

Gene name
Itih1
Definition
(RefSeq) inter-alpha trypsin inhibitor, heavy chain 1
  KO
K19014  inter-alpha-trypsin inhibitor heavy chain H1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    306251 (Itih1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   306251 (Itih1)
SSDB
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 VWA_CoxE SH3_15
Other DBs
NCBI-GeneID: 306251
NCBI-ProteinID: NP_001100761
RGD: 1306099
Ensembl: ENSRNOG00000033386
UniProt: B2RYM3
Position
16p16
AA seq 904 aa
MDGVTGLRVLLCLLTLQTMPALGLATGRPRGNEKRQAVDTTVNGVSIRSLKVNCKVTSRF
AHYVITSQVVNSANKAREVAFDVEIPKTAFISDFAITADGNAFIGDIKDKVTAWKQYRKA
AISGENAGLVRASGRNMEQFTIHITVGAQSKATFQLTYEEVLKRRLTQYDIVIKVRPKQL
VHHFEIDVDIFEPQGISRLDAQASFLSKELAAQTIKKSFSGKKGHVLFRPTVSQQQSCPT
CSTSLLNGDFKVTYDVNRDKLCDLLVANNYFTHFFAPQNLTNMSKNLVFVIDISGSMEGQ
KVKQTKEALLKILGDMKPVDNFDLVLFGSQVQSWKGSLVPASHANLQAAQDFVRRFSLAG
ATNLNGGLLRGIEILNRAQGSHPELSSPASILIMLTDGEPTEGETDRSQILKNVRNAIRG
RFPLYNLGFGHDLDFSFLEVMSIENNGWAQRIYEDHDATQQLQGFYNQVAHPLLTDVELQ
YPQDAVLALTQHRHKQYYDGSEIVVAGRIADHKLSTFKADVRAHGEKQEFKATCLVDEEE
MKKLLRERGHMLENHVERLWAYLTIQELLAKRMKTEGEERANLSSQILKMSLDYHFVTPL
TSMTIRGLTDEDGLEPIIDKPPEDSQPLEMVGPRRTFVLSAAQPSPTAHPIGSKLPTRVT
GVDTDPHFIIYVPTKEDSLCFNINEEPGVILNLVQDPDTGFSVNGQLIGIKAGSPGQHES
TYFGRLGVSSPTSDFQLEVTPQNITLNPSSGGPVFSWRDQAVLQKDGVVVTINKKRNLVV
SVDDGATFEIVLHRTWRGSSIHQDFLGFYVLDSFRMSARTQGLLGQFFSPLDFEVFDLRP
GSDPTKTDATMVVKNRQLTVTRGLQKDYSKDPRHGTEVSCWFVHDNGAGLIDGVHTDYIV
SDIF
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggatggtgtcacaggactacgggtgctgctgtgtctcctcactctgcagaccatgcct
gctctgggcttggcaacaggcagacccaggggcaatgagaagcgacaggctgtggacaca
acagtcaatggtgtgtccatcaggagcttgaaagtcaattgcaaagtcacctctcgcttt
gcccactacgtcatcaccagtcaggtggtcaacagtgctaacaaagccagggaagtggct
tttgatgtggaaatccccaagacagccttcatcagtgactttgccataacagcagatggg
aatgcattcattggggacataaaggacaaagtgactgcatggaagcaataccggaaggca
gccatttcaggagagaatgctggccttgtcagggcctcgggaagaaatatggagcagttt
accatccacatcactgttggagcccagagcaaggccacgttccagctcacctatgaggag
gtactaaagaggagacttacgcagtatgacatcgtcatcaaagtgagaccgaagcagctg
gtacaccattttgagattgatgtggacatctttgagccgcaggggatcagcaggctggat
gctcaagcctccttcctcagcaaggaactggctgctcaaaccatcaagaagtctttctcg
gggaagaagggtcatgtgctcttccgccccactgtgagccagcagcagtcctgccccacg
tgctctacctccttgctgaatggagacttcaaggtgacctacgatgtgaaccgagacaag
ctctgtgacctcctggtggccaacaattactttacacatttctttgccccccaaaacctg
accaacatgagcaagaacctggtttttgtgattgatatcagtgggtccatggaaggccag
aaagtgaagcagacaaaggaggcgctccttaagatattgggggacatgaagccagtagac
aactttgacctggtcctctttgggtctcaagtgcagtcatggaagggctcactggtaccc
gcgtctcacgccaatttgcaagcagcccaagactttgtgaggcgcttttctttggctgga
gccacaaacctgaatggaggcttgctccgaggaatcgagatcttaaacagagctcaagga
agccacccagaactcagcagccctgcctcaattcttatcatgttgaccgacggagagccc
actgaaggggagacggaccgttcccagatcctcaagaatgtccgcaacgctatccggggc
agattcccgctctacaaccttggctttggtcacgacctggactttagcttcctggaggtc
atgtccattgagaacaacggatgggcccagagaatttacgaggaccacgatgccacccaa
cagctacagggtttctacaatcaagtagcccaccccctgctgacagatgtggagctgcag
tacccccaggacgctgtcttggctctaacacagcaccgacacaaacagtactatgatggc
tctgagatcgtggtggctggacgcattgctgaccacaaactgagcacctttaaggcggat
gttcgggctcatggggaaaagcaagaattcaaggcaacctgcctggtggacgaggaagag
atgaagaagctgctccgagagcgtggccacatgctagagaatcatgtggagaggctctgg
gcctacctcactatccaggagctcctggctaagaggatgaagacagaaggggaagagagg
gccaacctgtcgtcccagatcttgaagatgtcactggactatcatttcgtaacgccgctg
acctctatgactatcagaggcctgacagacgaggatgggctggagcccatcattgacaag
cccccagaggattctcagcccttagagatggtgggacccagaagaacgtttgtgctgtca
gccgcacagccttctcctacagcccaccccataggctcaaagttgccaacccgtgtgaca
ggtgtggataccgatccccacttcatcatctatgtacccacaaaagaggatagcctgtgc
ttcaacatcaatgaggaacccggtgtgatcctgaacctagtgcaggaccctgacacagga
ttctcggtgaatgggcagctcattgggataaaggccggcagccctgggcagcatgagagc
acatactttgggagactgggggtctcaagccccacatcagactttcagctggaagtgact
cctcagaacattacactgaaccccagctctggcgggccggtgttctcctggagggatcag
gctgtgctgcagaaggacggggtagtggtgaccatcaacaagaagaggaacctggtggtg
tctgtggacgacggggctacctttgagattgtcctccacagaacatggagggggagttca
atccaccaggacttcctgggtttctatgtgctggatagcttccggatgtcagcccggaca
cagggactattggggcaattcttctccccactggattttgaagtatttgacctccgccca
ggctctgaccctacaaagacagatgccacaatggtggttaagaatcggcagctgacagtc
acccgagggttacaaaaggactacagcaaggaccccagacatggaacagaagtgtcttgc
tggtttgtccacgacaatggagctggactgattgatggcgtccacactgactatatcgtc
tctgacatcttctga

DBGET integrated database retrieval system