KEGG   Rattus norvegicus (rat): 306257
Entry
306257            CDS       T01003                                 

Gene name
Bap1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1
  KO
K08588  ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    306257 (Bap1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    306257 (Bap1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     306257 (Bap1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   306257 (Bap1)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    306257 (Bap1)
SSDB
Motif
Pfam: Peptidase_C12 UCH_C TFIIIC_delta
Other DBs
NCBI-GeneID: 306257
NCBI-ProteinID: NP_001100762
RGD: 1311938
Ensembl: ENSRNOG00000019097
UniProt: D3ZHS6 A0A0A0MXZ5
Position
16
AA seq 740 aa
MNKGWLELESDPGLFTLLVEDFGKNPFTPDRRALAGVKGVQVEEIYDLQSKCQGPVYGFI
FLFKWIEERRSRRKVSTLVDDTSVIDDDIVNSMFFAHQLIPNSCATHALLSVLLNCSNVD
LGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEA
FHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIR
FNLMAVVPDRRVKYEARLHVLKGNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKP
ASSKSPFGLEAGRTPAASECTHTDGAEEVAGSCPQTTTHSPPSKSKLVVKPSGSSLNGVP
PTPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPQQYSDDEEDYEDEEEDV
QNTSSAIRYKRKGTGKPGSLSNSSDGQLSVLQPNTINVLTEKLQESQKDLSIPLSIKTSS
GAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISK
VLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSTRSS
QGSQGSSSLEEKEVVEVTDSRDKSGLNRSSEPLSGEKYSPKELLALLKCVEAEIANYEAC
LKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRL
HKQRKPDRRKRSRPYKAKRQ
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagtgacccgggcctcttcaccctcctggtggaa
gatttcggtaagaacccctttacccccgatcgtcgggccctggctggtgtcaaaggggtg
caagtggaggagatctatgaccttcagagtaaatgccaggggcctgtatatggatttatc
ttcctgttcaaatggatcgaagagcgcaggtcccgccgcaaggtttctacgttggtggat
gatacatctgtgattgatgatgacatcgtgaatagcatgttctttgctcaccagctgatt
cccaactcttgtgccactcacgccttgctgagcgtgcttctgaactgcagcaatgtggat
ttggggcccacgctgagtcgaatgaaggatttcaccaaaggcttcagccctgagagcaaa
ggatatgcgattggcaatgcccctgaactggccaaggcacataatagccatgccaggcca
gaaccacgtcaccttcctgagaaacagaatggcctcagtgcagtgcggaccatggaggcg
tttcactttgtcagctatgtgcctatcacaggacggctctttgaattggatgggttgaaa
gtctaccctattgatcatgggccctggggagaggatgaggagtggacagataaagcccga
agggtcatcatggagcgaatcggccttgctactgcaggggagccctaccatgacattcgc
ttcaacctgatggcagtggtgcctgaccgcagggttaagtatgaggccaggctgcatgtg
ctgaaggggaaccgacaaacagtcctggaggccctgcagcagctgattagagtaacacag
ccagagctgattcagacccacaaatctcaagagtcacaactgcctgaggagagcaagcca
gccagcagcaagtctccctttgggctagaggcgggcagaaccccggcggcctctgagtgc
actcacacagatggtgcagaggaggtggctggttcgtgcccacaaactacaacccatagt
cctcccagcaaatctaagctggtggtgaagccttcagggagcagcctcaatggggttccc
ccaacccctacccctattgtccagcggctgccagcctttctagataatcacaattatgcc
aaatcccctatgcaggaggaggaagacctggcggcaggtgtgggccgcagccgagttcca
gtccgaccccagcagtactctgatgatgaggaggactatgaggatgaggaggaggatgtg
cagaataccagttctgccatcagatacaagcggaaggggacagggaagccaggatcgttg
agcaattcttcagatgggcagctgtcagtgctgcagcccaacaccatcaatgtcttaact
gagaagcttcaagagtctcagaaagacctttcaattcctctgtccatcaagactagcagt
ggggctgggagtccagccgtggctgtgcccacacactcgcagccttcacccacccctagc
aatgagagcacggacacagcctctgagattggcagtgctttcaactcacccttgcgctca
cccatccgctcagccaacccaacacggccctctagccctgtcacctctcacatctccaag
gtgctctttggagaagatgacagcctacttcgtgttgactgcatacgctacaaccgtgct
gtccgtgacctgggtcctgtcattagcacgggcctgctgcaccttgctgaggatggtgta
ctgagtcccctggcactcacagagggtgggaagggttcctcaccttctaccagatcaagc
caaggcagccaggggtccagcagcctagaggagaaggaggtggtggaagtcacagatagc
agagacaagtctgggctgaacaggtccagtgagcccttgagtggagagaagtactcgccc
aaggagctgttagcactgttaaagtgtgtagaggccgagattgcaaactatgaggcctgt
ctcaaggaggaggtggagaaaaggaagaagttcaagattgatgaccagcgaaggacccac
aactatgatgagttcatctgcaccttcatatccatgctggctcaggaaggaatgctggcc
aacctggtggagcagaacatctcagtgcggcgccgccaaggggtcagcattggtcggctt
cacaagcagcggaagcctgataggcggaaacgctctcgcccctacaaggccaaacgccag
tga

DBGET integrated database retrieval system