KEGG   Rattus norvegicus (rat): 306274Help
Entry
306274            CDS       T01003                                 

Gene name
Ercc6
Definition
(RefSeq) ERCC excision repair 6, chromatin remodeling factor
  KO
K10841  DNA excision repair protein ERCC-6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    306274 (Ercc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306274 (Ercc6)
   03400 DNA repair and recombination proteins [BR:rno03400]
    306274 (Ercc6)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    306274 (Ercc6)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      306274 (Ercc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C
Motif
Other DBs
NCBI-GeneID: 306274
NCBI-ProteinID: NP_001100766
RGD: 1311509
Ensembl: ENSRNOG00000030017
UniProt: D3ZS47
Position
16p16
AA seq 1325 aa AA seqDB search
MPHEEIPNSTQPQGQDWLPGQHVSADRDIPAGQETAGDSEAGKCLSSPSCDHGPSTSAEA
CVLAATRWGPALLHIDRHQIPAVEPSAQALELQGLGVDVYDQAVLEEGVLQQVDSAMHEA
SRVAQRADAEKEYQSVLDDLMSCTTSLRQINKIIEQLSPQAASNRDINRKLDSVKRQKYN
KEQQLKKITAKQKRLQAILGGAEVHVELDHGSLEEEDAEPGPSCLGSMLMPAQESAWEEL
IRTGQMTPFGTPAPQKQEKKPRKIMLNEASGFEKYLADQAQLSFKRKKQAANKRTAKKAV
VVSESSRGPNETKPNQRSQALSQTDKRLKKHIRKLQRRALQFQGKVGLQRGKRPLEPEER
PGAEGDTEAVLSSDDISYELKPLRKGQKYEKKVPVQEIDDDFFPSSEEEDEAVEGRGGGR
KVSRRPDDGDEDYYKQRLRRWNRLRLQDKEKLKLEDDSEESDAEFDEGFKVPGFLFKKLF
KFEGLGPTLIVCPTTVMHQWVKEFHTWWPPFRVAILHETGSCAHRKERLVRDIVHCHGVL
ITSYSYIRLMQDDISRHDWHYVILDEGHKIRNPNAAVTLACKQNNLRELWSLFDFTFPGK
LGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSL
PDKNEQVLFCRLTDEQHKVYQNFIDSKAVYRILNGENQIFSGLVALRKICNHPDLFSGGP
KNTSALPEDGLEEEQFGYWKRSGKMIVVESLLKIWHKQGQRVLLFSQSRQMLHILEVFLR
AHKYSYLKMDGTTTIASRQPLITKYNEDTSIFVFLLTTRVGGLGVNLTGANRVIIYDPDW
NPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFF
KSNDLYELFTLTSPDASQGTETSAIFAGTGSNIQTLKCHFKKRTPPVLQMDPKRKKPLVS
DTSVNGATVMEEKSQGSGATGSVPSTESGPLKSDRHTDGSRASSVGFGEEADAGSTLEHL
SGLSGDSPAVDHTSRLSAVASTSEKQGSSYEGECCQAQTGPVHLSEQTEGHFSKHKSKRK
HDAAEEETTEKCPQPKQKAKNSRHHRDAKFEGTRVPHLVKKRRYHQQTTEQESGAKDRSS
DDYVLEKLFKKSVGVHSVVKHDAIIDGSSPDYVLVEAEANRVAQDALKALRLSRQQCLGA
TSGVPTWTGHRGISGAPAGVKMRARNHMILPERLESDGEQLAGAAAAAAPPCSTEHDALL
VDMRNFIAFQAQVDGQASTQEILQAFESKLSVAQSCVFRELLRNLCNFHRTPGGEGIWKL
KPEYC
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgccccatgaggaaatccccaactccactcaacctcagggccaagactggttaccaggt
cagcatgtcagtgctgacagagacataccagctgggcaggagactgctggggactcagag
gcggggaagtgcctctcctctccttcctgtgaccatgggccgtccacatctgctgaagct
tgtgtactggcagccacaaggtgggggcccgccctgctgcacatcgaccggcatcagatt
cctgcggtggagcccagtgctcaggccctggagctgcagggcctgggtgtggacgtctac
gaccaggccgtcctggaggaaggtgtgcttcagcaggtggacagtgcaatgcatgaggcc
agccgtgtggcccagcgtgctgatgcggagaaagagtatcagtcagtcctggacgacctc
atgtcatgtacaacatccctgaggcaaatcaataaaattatagagcaacttagccctcaa
gctgccagcaacagagacatcaacaggaaactagattctgtgaaacgacagaagtacaac
aaggaacaacagctaaagaagataactgcaaaacagaaacgtctccaggccattctcgga
ggagcggaggtccatgtggaactggatcatggcagcttagaggaggaagatgcagagcca
ggcccatcatgtctcggcagtatgctcatgcctgcccaggagagcgcctgggaagaactt
atccgcactggccagatgacaccgttcggtaccccagcccctcagaaacaggagaaaaag
cctagaaaaataatgctcaatgaagcatcaggctttgaaaaatatttggcagaccaagca
caactttcttttaaaaggaaaaaacaagctgctaataaaagaacagctaaaaaagctgtg
gttgtatctgagtcaagccgaggaccaaatgaaactaagccaaaccagagaagccaagcg
ctctctcagacagacaagcgcctgaagaagcacatcaggaagctccagaggagggcgctg
cagttccagggcaaagtgggattgcaaagggggaagagacctctggagcctgaggagagg
ccaggggcagagggagacactgaggccgttctgtcttccgatgacattagctatgaactg
aagcctcttcggaaaggacaaaaatacgagaagaaagtcccagtgcaggagatcgacgat
gacttctttccaagttctgaggaggaagatgaagctgtggaaggaagaggaggaggccgc
aaggtctccaggcgcccagacgatggagatgaggattattataaacaacgattaaggagg
tggaataggctgaggctgcaggacaaagagaagctgaagcttgaagacgattctgaggag
agcgatgctgagtttgacgaaggtttcaaagtgccgggttttctgttcaaaaagctcttt
aagttcgagggactcggccccactctcattgtctgcccaacgacagtgatgcatcagtgg
gtgaaagaattccacacgtggtggcctccattcagagtggcgattctgcacgaaacaggc
tcctgtgcccacagaaaggagaggctggttcgagatattgttcattgtcatggagttttg
ataacttcgtattcctacattcgactgatgcaagacgacattagcaggcatgactggcac
tacgtcatcttagacgaaggacataaaattcgaaatccaaatgctgcagtcacccttgct
tgcaaacagaataacctgcgagagctgtggtcactcttcgactttaccttcccaggaaag
ctaggcacgttgcctgtgttcatggagcagttctctgtccccatcaccatgggggggtac
tccaatgcttccccagtacaggttaaaactgcctataagtgtgcgtgtgtcttgagagac
acgataaacccgtacctactgcgaagaatgaaatcagatgtcaagatgagcctttcgctg
ccagataaaaatgaacaggtcttattttgccgtctaactgatgagcagcataaagtctac
cagaatttcatcgattccaaagcagtttacaggattctcaatggagagaatcagattttc
tctggacttgtagctctgaggaagatctgcaaccaccctgacctcttttctggcggtccc
aagaacaccagtgctcttccagaggatggactggaggaggagcagttcggatactggaaa
cgctctgggaaaatgattgttgttgagtctttgctgaaaatctggcacaagcagggtcag
cgggtgctgctgttttcccagtcaaggcagatgctgcacatactggaagtgttcctgaga
gcccacaagtattcctatctcaagatggatgggaccactaccatagcatccaggcagccg
ctgattacaaaatacaatgaggacacgtccatctttgtctttcttctgaccacacgggtg
ggcggcttaggagtgaacctgaccggggccaacagagtcatcatctacgaccctgactgg
aatccaagcaccgacacacaggcacgggagcgagcatggaggatcggccagaagaagcag
gtgactgtctacaggcttctgacggccggcaccatagaggaaaagatctatcaccgacaa
atcttcaagcaatttttgacaaacagagtgctaaaagaccctaaacaaaggcgctttttc
aagtccaatgatctctatgagctgtttactctgactagtcctgatgcctcccagggcact
gaaacaagtgctatttttgcaggaaccggatctaatattcagacactgaaatgccatttt
aaaaagaggactccgccagtcctacaaatggatcccaaacgcaagaagcccctggtttct
gacacatctgtaaatggtgccactgtgatggaagaaaaatctcaggggtcaggagctacg
ggcagtgtcccttctacagaaagtggccctttgaaaagtgaccgtcacacagatgggagc
agagccagcagtgttggttttggagaagaggcagatgcagggtccacgctggagcatctc
tcagggctgagtggagattctccagcagttgaccacacatccaggctgtcagctgtggcg
agcaccagtgagaagcagggctcttcctatgaaggggagtgctgccaggctcagacggga
cctgttcacctgagtgaacaaacggaaggtcatttctctaagcacaaatcaaaaaggaaa
catgatgcagcggaggaagagaccacagagaagtgtccacagcccaagcaaaaggccaag
aactccaggcatcacagagatgctaagtttgagggaactcgagtcccacacctggtgaag
aagaggcggtaccatcagcaaaccactgagcaggagagcggagccaaggaccggagcagt
gatgattatgttttggaaaagcttttcaaaaaatcagtgggcgtgcacagcgtcgtgaag
catgatgccatcatagatgggtccagtccggattatgtgctggtggaggcagaagccaac
agagtggctcaggatgccttgaaagctctgaggctctctcgtcagcagtgcctgggggca
acatctggtgttcccacctggactggccacaggggtatttccggtgcaccagcaggagta
aaaatgcgagcacgaaaccacatgattttgccggagcgtttggagagtgacggcgagcag
cttgctggggctgcggctgcggctgcgcctccctgcagcacagagcacgacgcccttctg
gtggacatgaggaacttcattgctttccaggctcaggtggatggccaggccagcactcag
gaaatcctacaggcgttcgaatccaagctgtctgtggcacagtcctgtgtcttccgagaa
ctactgaggaatctgtgcaatttccatagaactcctggtggtgaagggatttggaaactg
aagccagagtactgctaa

DBGET integrated database retrieval system