KEGG   Rattus norvegicus (rat): 306376Help
Entry
306376            CDS       T01003                                 

Gene name
Sh2d4a
Definition
(RefSeq) SH2 domain containing 4A
  KO
K17577  SH2 domain-containing protein 4A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    306376 (Sh2d4a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     306376 (Sh2d4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 TcpA
Motif
Other DBs
NCBI-GeneID: 306376
NCBI-ProteinID: NP_001012048
RGD: 1307991
Ensembl: ENSRNOG00000013541
UniProt: Q6AYC8
Position
16p14
AA seq 422 aa AA seqDB search
MLRQILSEMFIDPDLLAELSEEQKQILFYKMREEQIRRWKEREAAMERKESLPVKSRPKK
ENGKSVHWKLGADKQVWVWVMGEHHLDKPYDVLCDEILAEREHLRAAKDAELRKAQSLQF
TNSLKVKSLNCDLQAVKKTEPQNVTRKAAAEEATDQGPRAIPTKKDDKAQTKDLTKKKDS
EELKQTEDEKTKQIYKNWKEDSEWQASLRKSKAADEKRRSLAKQAREDYKRLSQRGRSGD
GLQNPLTGPQKPKRPPLPPKPQFLQPLGSPPKSLGNQGVIRTKTSSTQEDIIRWFKEEQL
PFRAGYQKNSDTIAPWFHGILTLKKANELLSTGMPGSFLIRVSEKIKGYALSYLSEEGCK
HFLIDASANSYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLFPCGQQDKPPDYLEL
FQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggcagatactgtcggagatgttcatagaccctgacctgctggcagagctcagc
gaagagcagaaacagatcttgttctacaagatgagagaggaacagatccggcgatggaaa
gaaagagaagcagccatggaaagaaaggagtccttgccagtgaaatccaggccaaagaaa
gagaatggcaagtctgtgcattggaagctgggcgctgataagcaggtgtgggtttgggta
atgggcgagcatcatctggacaaaccctatgatgtgctgtgtgatgagatccttgctgag
agggagcacctgagagcagcgaaggatgcagagctcaggaaagctcagtctctacagttc
accaatagcttaaaagtaaagtcactgaactgtgatctgcaagcagtgaaaaagacagag
cctcagaatgtcactaggaaagcagctgcagaagaggcaacagatcaaggacccagagca
ataccaaccaagaaggacgacaaagcccaaactaaagacctcaccaagaaaaaggacagt
gaggaactgaagcagacagaggacgagaaaacgaagcagatatacaagaactggaaagaa
gactccgaatggcaagcatctttgcgaaaatctaaggcagctgatgagaagagacgctcc
ttagcgaaacaagcacgggaagactacaagaggctttctcaaaggggaaggagtggcgac
gggctgcagaacccactgactggtccacagaagcccaaaagacctcctcttcctccgaag
ccccagttcctacagccgctgggaagccctccaaagtctttagggaatcagggagtaata
aggaccaagaccagctccacccaggaggacatcatccgatggttcaaagaggaacagctg
ccattccgagcaggttaccagaaaaactcagacaccattgctccctggttccatgggatt
ctcacactgaagaaagcaaatgaacttctgagcacaggcatgccaggcagttttctcatc
cgagtcagtgaaaagatcaagggctatgccctgtcctacctgtctgaggaaggctgcaaa
catttcctcatagatgcatcagccaactcttacagcttcctgggtgtagaccagctgcag
catgctaccctggcagatttggtggaatatcacaaggaggagcctataacctctctggga
aaggaactcctgttgttcccctgtggtcaacaagacaagccacctgactacctggagctc
ttccagtga

DBGET integrated database retrieval system