KEGG   Rattus norvegicus (rat): 306439Help
Entry
306439            CDS       T01003                                 

Gene name
Gpm6a, M6a
Definition
(RefSeq) glycoprotein m6a
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Myelin_PLP DUF2701
Motif
Other DBs
NCBI-GeneID: 306439
NCBI-ProteinID: NP_835206
RGD: 631368
Ensembl: ENSRNOG00000010731
Vega: OTTRNOG00000002288
UniProt: Q812E9
Position
16p11
AA seq 278 aa AA seqDB search
MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT
YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT
TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICRNTTLVEGANLCLDLRQF
GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA
YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaatatggaagaaggacagacacaaaaagggtgttttgagtgctgcattaaa
tgcctgggaggtattccctatgcttctctgattgctaccatcctgctgtatgcaggcgtt
gccctgttctgtggctgtggtcatgaagccctttctggaacagtcaacattctgcagacc
tactttgagatggcaagaactgctggagacacactggatgtttttaccatgattgatatc
tttaagtatgtgatctacggcattgcggctgctttctttgtctatggcattttactgatg
gtggaaggtttcttcacaactggggccatcaaagatctctatggggacttcaaaatcacc
acctgtggcagatgtgtgagcgcttggtttatcatgctgacatacctcttcatgttggcc
tggctgggagtcacagcttttacctcactgccagtgtacatgtatttcaacgtgtggacc
atctgccggaatactacactcgtggagggagcaaatctctgcttggaccttcgtcagttt
gggattgtgacaattggagaggaaaagaaaatttgtactgtctctgagaacttcctgagg
atgtgtgaatctactgagctgaacatgaccttccacttgttcattgtggcccttgctgga
gcaggagcagcagttattgctatggttcactaccttatggttctgtctgccaactgggcc
tatgtgaaagatgcctgccggatgcagaagtatgaagacatcaagtcaaaggaggagcaa
gagcttcatgacattcattccacccgctccaaagagcggctcaatgcatacacataa

DBGET integrated database retrieval system