KEGG   Rattus norvegicus (rat): 306469Help
Entry
306469            CDS       T01003                                 

Gene name
Cfap97, RGD1307325
Definition
(RefSeq) cilia and flagella associated protein 97
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: KIAA1430
Motif
Other DBs
NCBI-GeneID: 306469
NCBI-ProteinID: NP_001014023
RGD: 1307325
Ensembl: ENSRNOG00000032192
UniProt: Q66H34
Position
16q11
AA seq 548 aa AA seqDB search
MDRFGDISEGEVDHSFFDSDFEDTKKCESNSIFDKQNDDDFKEGINKDIKNLNLKFGVQN
DNLKEKIDNDTENVNVKLGIQTKENYLTQKGNERKPKFPSKEQHVENDPIQTRSPSLLTS
SRSKKLCDTTKGNKLHLPVPNRIPKIVKGEDDYYTDGEESSDDGKKYHVRSKSAKPSSNL
KKNNTSKKYSKASSSSLSSSSSRSSSDCSDIGSDMQNKPDSGSSGKRVSSVTPSSPKQKC
KSGRKSSAKQKAGDYNAESEDNVTDVTPASTPDSSPAQPFELSQSQNQKVKVKRQENVSR
DVYEDVEALKNDSRCLKSAKRKEKHGQNFAPKSSVLDANLDRRSKQKVLHDTMDLNHLLK
AFLQLDKKGPQKHHFEQPSIIPRKNYSFTREEVRQIDRENQRLLKELSRQAEKPGNKSTI
PGRSLGHPPKLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNISY
LNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCKTDRSVLDTSSGFLLRPKPPNIQCS
NSKVLRSH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggatcggtttggcgatatctcagaaggtgaagtggaccattctttctttgacagtgat
tttgaagacacaaagaaatgtgaaagtaattccatttttgacaagcaaaatgatgatgac
tttaaggaaggaataaataaggacatcaaaaatttaaacttgaaatttggagtacaaaat
gataaccttaaagagaaaatagataatgacacagaaaatgtgaacgtgaaacttgggata
caaacaaaggaaaattaccttactcagaagggaaatgaaaggaaaccaaaatttccctca
aaggaacaacatgtagaaaatgaccctatacaaacaagaagtccctcattgttgacttct
tcaaggtcaaaaaaactgtgtgataccacaaaaggaaataaactacatttgcctgttcca
aatagaattcctaaaattgtgaaaggtgaggatgactactacacagatggagaggaaagc
agtgacgatgggaagaagtaccacgtgaggtctaagtcagcgaagccctctagtaactta
aaaaagaacaacacaagtaagaagtattccaaagccagttcctcctctctgtcttcctca
tcttcacgatcaagctcagactgctcagatataggatctgacatgcaaaataaacctgat
tcaggttcatcagggaaacgagtttctagtgtaaccccctcatcaccaaagcagaagtgt
aagtcaggaagaaaatcaagtgctaaacagaaggcaggtgactataatgcagagtcagaa
gacaacgtaacagacgtaactcccgcgtcaactccagacagcagccctgcccagccattt
gagttgagccaatcacagaatcaaaaagtaaaagttaaaagacaagaaaatgtgagccgg
gatgtgtatgaggatgtggaggctttaaagaatgattcaagatgtctgaaatcagccaaa
aggaaagaaaagcatggacagaattttgctccaaaatcatcagtgttagatgcaaatcta
gaccgtagatccaagcaaaaagtcttacatgacacaatggaccttaatcatctgttgaaa
gctttcctgcagttagataaaaagggaccacagaaacatcactttgagcagccttcaata
atacctaggaaaaactactctttcacaagagaagaggtgagacagattgatcgggagaat
cagaggcttttgaaagaactgtcaagacaggctgaaaaaccaggaaacaaaagtacaatt
cctggaagatcgctcggccatccacctaagttgtatcacagtgctctcaacagacagagg
gaacagcaaaggattgaaagagaaaatatggctttattgaaacggcttgaagctgtgaag
ccaacagttggcatgaaacgctctgaacagctgatggactaccatcggaatatcagttac
ctcaacccttcaccgtccgtcagacgagtgagatctactcttggccattacagcccactg
agaggagcttccaggacatccagtgcaaccagtggtctcagttgtaagactgatcgatca
gtgttggacacatccagtggctttttgctaagaccgaaacccccgaatatacaatgcagc
aactccaaagtattaagatcacactaa

DBGET integrated database retrieval system