KEGG   Rattus norvegicus (rat): 306506Help
Entry
306506            CDS       T01003                                 

Gene name
Pragmin, RGD1311793
Definition
(RefSeq) pragma of Rnd2
  KO
K17537  tyrosine-protein kinase SgK223 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    306506 (Pragmin)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     306506 (Pragmin)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NKF3 family
   306506 (Pragmin)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 306506
NCBI-ProteinID: NP_001100785
RGD: 1311793
Ensembl: ENSRNOG00000011407
UniProt: D3ZMK9
Structure
PDB: 

Position
16q12.2
AA seq 1368 aa AA seqDB search
MSACSDFVEHIWKPGSCKNCFCLRSDHQLTAGHPKARASSLPAGARLPARPEICRLEDEG
VNGLAYSKPTIAVKPTMMTSETADLWTEASLSAEVPKVNWRRTPGKLLLQKQEDGPIVYL
GSFRGMQKAAGPLACTDSNSRCPPAYTMVGLHNLEARVDRNTALQPVNFQEEKAGREELP
SAQESFRQKLAAFTGMTSSCLKGPRPCTSPQPLRESLPSEDDSDQRCSPSGDSEGGEYCS
ILDCRPESRDAVHNTEGSGRRRGDCSPICWEQGTCTRPTEEEKQALNFPRECCGQGSTAN
PPHLGPKKPSLNSEAASSSDGLSCGSSRSGANSPFAPHLENDYCSLVKEPTSVKQQDSGC
HLVNSGKYVGQAVDLQPPALPREAVQPEPIYAESAKRKKAAPVPQRPEPKKEQVSSGQVW
TGDTWSQKTPSGWSQEREGPNAAPQVATTITVIAAHPEEDHRTIYLSSPDSAVGVQWPRG
SLNQDLHGSGEEPLVVQGLSSRESHPHNMTENSSKEKPAIPPKLSKSSPGGSPVSPAAPP
LTDHSDGNTSGSSVGSQPSSRVPTNLTSSCQTNGVAAGDPAKCPPQANSSVLDQRRPRYQ
TGAWSRQCRIEEEEEVGQELLSQSWGRELENGIADHSNSSTWHRLHPIDGASGQNGKTNS
GMSKSASFAFEFPKDRGRLESFSPPPPPPKSRHLLKMNKSSSDLEKVSQSSAESLSPSFR
GAHVSFTTGSTDSLASDSRTCSDGGPSCEATHSPTISGKKLFAPVPFPSGSTEDVSPSGP
AQPPPLPQKKIVSRAASSPDGFFWTQGSPKPRTASPKLNLSHSETNVCAHDEPPLSYSLN
SGNHPHHVFSSSEPLEKAFKGSVPWAPALGPANSKGGCGSPNLQGRAATSTSSSQLSVSS
QASTGSSQLQLHSLLSSISSKEGTYAKLGGLYTQSLARLVTKCEDLFMGGLKTELRFDEN
SWSLFKLICNKPCCDSGDAIYYGATCSKDPDSIYAVKICKTPEPKSASYCSPSVPVHFNI
QQDCGHFVASVPSSMLAFPDTSSKDPAPAAPSHTPAQEQDCVVVITREVPHQTASDFVRD
SVASHRAEPEVYERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVHCNPQSSPGPSA
NPSVPTTTSRCPSAAPAATTACQGGPGEKHLPRLIISNFLKAKQKPGGTTNLQQKKSQAR
LAPEIVSASQYRKFDEFQTGILIYELLHQPNPFEVRAQLRERDYRREDLPPLPTLSLYSP
GLQQLAHLLLEADPIKRIRIGEAKRVLQCLLWGPRRELVEQPCPSEEVLCNTLHNWIDMK
RALMMMKFAEKAVERRRGVELEDWLCCQYLASAEPGALLQSLKLLQLL
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtgcagtgactttgtggagcacatctggaaacccggatcctgcaagaactgc
ttctgcttgaggagtgaccatcagctcacagctggccaccccaaagctagagccagcagc
ctacccgctggagctcgcctgcctgccaggcctgagatttgccgcttagaggatgaaggt
gtgaatggcttggcctactcaaagcccaccattgcggtaaagcccaccatgatgacttct
gagactgccgacttgtggactgaggccagcctgagcgctgaagttccaaaggtcaactgg
agacgaactccaggcaagctcctgctccagaaacaggaagatgggccaatagtttacctc
ggcagcttccgaggaatgcagaaggctgcaggccctctcgcctgcacagatagcaactct
cgttgtcccccagcctacaccatggtcggactgcataacctggaggcccgagtggatagg
aacaccgccctccaaccagtgaatttccaggaagagaaggctgggagggaagagctgccc
tcagctcaggagagctttcgtcagaagctagctgcctttacagggatgacgtccagctgc
ctcaagggccccagaccctgcacttctccacagcccttgcgggagtccctgccctcagag
gatgacagtgaccaaaggtgctcaccctcaggagacagcgaaggtggggagtactgctcc
attttggactgtcgtccagaatccagagatgctgtgcataacaccgagggctctggccga
cggcgaggggactgctcacccatatgctgggagcagggaacatgtacaagaccaacagaa
gaggaaaagcaggctctgaacttccccagagagtgttgtggtcagggatccacagcaaac
ccaccccacctgggccccaagaagccgtcccttaactcagaggctgccagctcttcagat
ggtctgtcctgtggcagcagccgcagtggtgccaacagcccctttgctccacacctggag
aatgactactgctctcttgtgaaggagccaacctcggtgaagcagcaggactctggctgc
cacttagtcaactctggcaaatatgtgggtcaagccgtggacctccagcccccagccctt
cctagggaggctgtgcagcctgaacccatctacgccgaaagtgccaagaggaagaaggca
gctccggtgcctcagaggcccgagcccaagaaagagcaggtctcgtctggccaagtatgg
acaggcgatacctggtctcagaagacaccctctggctggagccaggaaagggaaggccca
aacgctgctcctcaggtggcaaccactattactgttattgctgctcacccagaagaggac
cataggactatttatctgagcagcccagactctgccgtgggggtgcagtggccacgtggg
tctttgaaccaggacttacatggtagtggagaagagcctttggtcgtgcaggggctaagc
tcaagggagagccatccacataatatgacagaaaactcgtccaaagaaaagcctgccata
ccccccaagctgtccaaaagcagcccgggagggtccccggtgtcacctgcagccccccct
ctgactgaccacagtgatgggaacaccagtggcagcagtgtcggatctcagccttcgtct
agagtccctactaacctaacttcttcctgccagaccaatggtgttgccgccggtgaccct
gccaagtgtcccccacaagccaactcttcagtcttggaccagaggcggccaagataccag
actggtgcatggagccgccagtgccggatagaggaggaggaagaggtggggcaggagttg
ttgagtcaaagttgggggagagagttggaaaatggtattgcagaccattcaaactcctct
acctggcaccggctccatcccattgatggcgcctctgggcagaacggcaaaactaactct
gggatgagcaaatcagcttcctttgcgtttgagttcccaaaggacagaggcagattggag
tcattctcaccccctcccccacctccaaagtcaaggcacctgttaaaaatgaacaagagc
agctctgacttggagaaagtgagccagagctctgcagaaagcctcagcccgtccttccga
ggggcccacgtcagcttcaccacgggctccacagatagcctagcctcggactccaggact
tgcagcgatggaggtccatcgtgtgaagccacccactcacccaccatcagcgggaaaaag
ctctttgctcccgtccctttcccgtcaggctccacggaggatgtgtcccccagcggtcct
gcacagcctcctcctctgccccagaaaaagatagtgagccgtgctgcctcctcccctgat
ggcttcttctggacccaaggttcccctaagccacgcacagcgagtcccaagctgaaccta
agccactcggaaaccaatgtttgtgcccatgacgagcctcctttgagctattccttgaac
tctggaaaccatccccaccatgtcttctcctcttctgagcctttggagaaagctttcaaa
ggcagtgtcccctgggccccagctctgggtccagcaaacagcaaaggcggttgtgggagc
cccaatctccagggcagagcggccacctccacctcgtcatcccagctcagcgtgtccagc
caggcctccaccggcagcagccagcttcagctgcacagcctgctgagcagtatcagcagc
aaggagggcacctatgccaagctcgggggcctctacacacagtccctggcccgcctagtg
accaagtgcgaagacctcttcatgggtggtctgaaaacggaactgcgcttcgatgagaac
agctggtcgctcttcaaactgatatgcaacaagccttgctgtgactcgggagatgcaatt
tactacggtgccacttgctccaaggaccccgacagcatctacgcagtgaaaatctgcaaa
accccagaacccaagtcagcttcgtactgtagcccgtccgtgccagtgcacttcaacatc
cagcaagactgcggccactttgtggcctctgtgccctccagcatgcttgccttccccgac
acatccagcaaggaccctgcgcctgctgcgccctcacacacccctgcccaggagcaggac
tgtgtggtggtcatcacccgggaggtgccgcaccagactgcctcggactttgtgcgggac
tctgtggccagccaccgcgcagagcctgaggtttacgagcgccgggtgtgcttcttgctt
ctgcagctctgcaacgggctggagcatctgaaggaacatgggatcatccaccgggaccta
tgtctggagaacctgttgctagtgcattgcaaccctcagagctctcccgggccctctgct
aatcccagcgtgcccaccaccacgtcccgttgtccttctgccgcacccgcagccaccaca
gcctgccagggaggacctggtgagaagcacctgcccaggctgatcatcagcaacttcctg
aaggccaagcagaagccgggaggcaccaccaacctgcaacagaagaagagccaggcccgg
ctggcccctgagatcgtatctgcctctcagtaccgtaagtttgatgagttccagactggc
atcctcatctacgagctgctccaccagcccaacccattcgaggtgcgagcccagctacgg
gagcgtgactaccggcgggaggacctacccccgctgcccacactgtcgctctactcgccc
ggcctgcagcagctcgcccacctgctccttgaggccgatcccatcaagcgcatccgcata
ggtgaggccaagcgggtgctacagtgcttgctgtgggggccacggcgagagctggtagag
cagccgtgcccctcggaggaggtactgtgcaacactctgcacaactggatcgacatgaag
cgagccctgatgatgatgaagtttgccgagaaggcggtagaacgaaggcggggtgtggag
ctggaggattggctctgttgccagtacttggcctcagcagagccaggggccctcttgcag
tccctgaagctcctgcaacttctctga

DBGET integrated database retrieval system