KEGG   Rattus norvegicus (rat): 306575Help
Entry
306575            CDS       T01003                                 

Gene name
Ckap2
Definition
(RefSeq) cytoskeleton associated protein 2
  KO
K16769  cytoskeleton-associated protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306575 (Ckap2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    306575 (Ckap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CKAP2_C DUF5462
Motif
Other DBs
NCBI-GeneID: 306575
NCBI-ProteinID: NP_001162610
RGD: 1311631
Ensembl: ENSRNOG00000024650
UniProt: D3ZPD0
Position
16q12.5
AA seq 676 aa AA seqDB search
MAESRKRSLGRPARSTLRVPRDLQLPPTKRDQPAFREQRKEKLKEYLLIRKTTFPYKQEN
QISRDQKMVTSEDQVQEGKKVVKLKTEVADKENIGSIVEKNCVPLKAEEVASSETHHPKG
DVQAVQLLSTGADFPGQPVMLDQACHHKDSAGTQVTAEKTKQDTNMSKKRVLGYYHGQIV
QSKINSFRKLPSVKDESLAATKKLPTTVSKARKAHIEPGKAVSVRASNTAAATRSTDTNS
GSALSKNTLVRPPIRSLHSRTHGGTLGAVKQGLGGTLDSVTVRKESLEKESHRPEPVMSV
VKTSSSQDTKRGKAPPRSIACKDVTRTNSSNARLTGKSRDPDQRRYTIAGAAVLRSAQPK
DTTADRKAQMTDWRTGKGKGLKRPPHSEVTQAEPKRQNENAVGSFWTTMAEEDEQRLFTE
KVNKTISECLNLINKGCPKEEILATLNDLIHNIPDAKKLVKYWICLVRIEPITSPIENII
SIYEKAILAGAQPIEEMRHIIIDILTTKNQEKANLGENIEEAHATKEHIQEVNVETNLGS
GKPEEENEHHRKVEVYEDNQDSKTEDPTNDLTTPDSKAEAGCLIRYNVSSTPRLQSMKKT
QHDKNSTFKELKFLTPVRRSRRIQEKTLRLPDMLKDHDPSVSSLEQLSELGGDAFVCRPN
AALCPLFCETDVVEEE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtccaggaaacgctcccttggccggcctgcgaggagtaccttgcgggttcct
cgggacctgcagctgcccccgaccaagagagaccagccggccttcagagaacaaagaaaa
gaaaaactcaaggaatatctgttaatacgaaaaacaacgtttccatacaaacaagagaat
cagatatccagagatcagaaaatggtgacatctgaggatcaggtccaagaagggaaaaaa
gttgtgaaactcaaaacagaagtggctgataaagaaaatattggaagtatagttgaaaaa
aactgcgttccattaaaggctgaagaagtagccagctcagaaacgcaccacccaaagggt
gatgtgcaagccgtgcagctgttatccaccggagcggatttcccaggtcagcccgtgatg
ttagaccaggcttgtcaccataaagacagtgcagggacgcaagtgacggcagagaagacg
aagcaagacactaacatgtctaaaaaacgagtgcttggctattatcacggccagattgtt
cagtctaagatcaattcattcagaaagcttcccagtgtcaaagacgagagtctcgcagca
accaagaaactccccactactgtgtctaaagccaggaaggctcacattgagcctgggaag
gccgtcagtgtcagagcctcaaatacagctgctgccaccaggtctacagacactaactcc
gggagcgccttgtccaagaacacacttgtgcgaccacctatccgaagtctccacagtaga
acccacggcgggaccctcggtgctgtgaagcaaggcctcggcgggacccttgacagtgtt
acagtcagaaaagagtcgcttgaaaaggagtcacatcgaccagaaccggtcatgtctgtt
gtcaaaaccagttcttctcaggacacaaaaagaggcaaggccccaccaagaagcatagca
tgtaaagatgtaaccaggactaactcatctaatgccaggctgacaggaaagtccagagat
cctgaccagcgcagatacacgatcgcaggagcggctgtccttagatcagctcagcccaaa
gataccacagcagacaggaaagctcagatgaccgactggagaactggcaaagggaagggg
ctaaaaaggcctcctcattcagaggtcacccaggctgagcccaagagacaaaacgaaaac
gcagttgggtccttttggaccaccatggcagaagaagacgagcagagattattcactgaa
aaagtaaacaaaacgatttctgagtgcctgaacctcattaataagggatgcccaaaagaa
gaaattttagctacactgaatgacctgattcataatattccagatgccaagaaacttgtt
aaatattggatatgtcttgtacgtattgaaccaatcacaagtcctattgaaaatattatt
tcaatctacgagaaggccattctggcaggggctcagcctattgaagagatgcgacatata
atcatagatattctaacaacgaagaatcaagaaaaagccaatttgggagaaaatattgag
gaggctcatgcaaccaaggaacatatccaagaagtaaatgttgaaactaatctcgggtca
ggaaaaccagaagaggagaatgaacatcatagaaaagttgaggtttacgaagacaatcag
gacagcaaaacagaagatccaaccaatgatctaacaaccccagactcaaaagccgaggca
ggttgcctgattcgatataatgtatcttctacaccacgcttgcaaagtatgaaaaagacg
caacatgataaaaattccacatttaaagagctaaagtttctgacacccgtgagacgttcg
cgccgcattcaagagaagactttacgactgccagacatgttaaaagaccatgacccttcc
gtgtcttccctggagcagttgtcggagttgggaggggatgcttttgtttgccgccctaat
gcagccctgtgccctctgttctgtgagaccgacgtcgtggaggaggaatag

DBGET integrated database retrieval system