KEGG   Rattus norvegicus (rat): 306589
Entry
306589            CDS       T01003                                 

Gene name
Klhdc8b
Definition
(RefSeq) kelch domain containing 8B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 Kelch_5 DUF1668
Other DBs
NCBI-GeneID: 306589
NCBI-ProteinID: NP_001007686
RGD: 1359445
Ensembl: ENSRNOG00000047867
UniProt: Q5XIA9
Position
8q32
AA seq 354 aa
MAAGGGQAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLADEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVLVYESRRDRWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGNIVAIGGLGNQPCPLASVE
SFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctgcaggaggtggccaggcctttgcttggcaggtgttcccccccatgcccacttgc
cgggtctatggcacagtggcgcaccaggatggacacctgctggtgttagggggctgtggc
cgggctgggttacctctggacactgctgagacattggacatggcctcacacacatggctg
gcattagcacccttgcccaccgcccgggctggtgcagctgctgtggttctgggtaagcag
gtgctagtggtgggtggcgtggatgaagtccagagcccagtagctgctgtggaggccttc
ttggctgatgaaggccgctgggagcgccgggcgaccctccctcaagcagccatgggtgtt
gcgactgtggagagagatggtatggtgtatgccctggggggaatgggtcctgacacggcc
ccccaggcccaggtactggtctacgagtcccgccgggaccgctggctttcgctaccctcc
atgcctacaccctgctacggggcctccaccttcctgcacgggaacaagatctacgtcctg
ggaggtcgccagggcaagctcccagtgactgcttttgaagcttttgatctggagacacgt
acatggacccgacacccaagtctgcccagtcgccgagcttttgctggctgtgctatggcg
gaaggcagtgtctttagcctgggtggcctgcagcagcctggcccccacaatttctactcc
cgcccgcattttgtcaacactgtggagatgtttgacctggagcatggatcctggactaag
ctgcctcgtagcctgcggatgagggataaaagggcggattttgtggttggctcccttggg
ggcaacattgtggctattgggggtcttgggaaccagccgtgccccttggcctctgtggag
agcttcagtcttgcacggcgacgctgggaggcactgcctgccatgcctacagcccgatgc
tcctgttccagcctgcaggctgggccccgactatttgttattgggggtgtggcccagggc
ccgagtcaagctgtggaagcactgtgtctacgtgatggagtctga

DBGET integrated database retrieval system