KEGG   Rattus norvegicus (rat): 306599Help
Entry
306599            CDS       T01003                                 

Gene name
Tubgcp3
Definition
(RefSeq) tubulin, gamma complex associated protein 3
  KO
K16570  gamma-tubulin complex component 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306599 (Tubgcp3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    306599 (Tubgcp3)
   04147 Exosome [BR:rno04147]
    306599 (Tubgcp3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     306599 (Tubgcp3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     306599 (Tubgcp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306599 (Tubgcp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_N_terminal GCP_C_terminal SpoIIAA-like
Motif
Other DBs
NCBI-GeneID: 306599
NCBI-ProteinID: NP_001100793
RGD: 1305726
Ensembl: ENSRNOG00000017085
UniProt: D3ZMR7
Position
16q12.5
AA seq 606 aa AA seqDB search
MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQFAVRVIGSNFAPTVERDEFLVAEKIKK
ELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLNLSEDPRKQASKVTSYASLFAQ
ALPRDAHSTPYYCARPQTLPLNYQDRSTQSSGSLGSSGISSIGMCGLSGPTPVQPFLPGQ
SHQAPGVGDGLRQQLGPRLAWTLTGNQPSQTPTSKAFPNALSRNLTRSRREGDPGGTSEV
TEAALVRDILYVFQGIDGKNIKMSSTENCYKVEAKANLSKSLRDTAVRLAELGWLHNKIR
KYADQRSLDRSFGLVGQSFCAALHQELKEYYRLLSVLHSQLQLEDDQGVNVGLESSLTLR
RLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMKSLVQHILSLVSHP
VLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFITMDQSRKVLL
IGKSINFLHQVCHDQTPTTKMIAVTKSAESPRDAADLFTDLENAFQGKIDAAYFETSKYL
LDVLNRKYSLLEHMQAMRRYLLLGQGDFIRHLMDLLKSLLVTLGGMSSAWITTSTDQLPL
CSHESA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccggatcagaagtcgcccaatgttctgctgcagaacctgtgctgccggatc
ctaggccggagcgaagccgatgttgctcagcagttccagtttgctgtgagagtcatcgga
agcaactttgctccaactgttgaaagagatgaatttctagtagctgaaaaaatcaagaaa
gaacttattcgacaaaggagagaagcggacgccgcactgttttcagagctccaccgaaag
cttcattcgcagggagttttgaagaataaatggtcaatcctctacctcttgctgaacctc
agtgaggatcctcggaagcaagccagcaaggtaactagctatgcctccttatttgcacaa
gccttaccgagagacgctcactcgacgccttactactgtgccaggcctcagaccctcccc
ttgaactaccaggaccgcagcacacagagctctggcagcttgggcagcagcggcatcagc
agtatcggcatgtgtggccttagcggccccacacctgtgcagcctttcctccccggacag
tctcatcaagctccaggagtgggtgacggccttcggcagcagctggggcctcgtctagca
tggactctgactggaaatcagccttcacagacccctacctccaaggctttcccaaatgct
ctttctcgaaacctgacaaggtcaaggagagaaggggatccaggtggcacatcggaagta
actgaagcagctcttgtgagagacattctctacgtattccagggcattgacggcaaaaac
atcaaaatgagcagcactgaaaactgttacaaagtggaagcgaaggcaaatctaagtaag
tccttgcgggacacggcggtccggcttgctgaattggggtggctacataataaaatcagg
aagtatgctgaccagaggagtctggaccgctcgtttggacttgtagggcagagtttttgt
gctgcgttgcaccaagagctcaaagaatactacaggctcctctctgttctgcactcccag
ctccagctagaagatgatcagggtgtgaatgtgggactggagagtagcctcacactgcgg
cgcctcctggtttggacatatgatcccaaaataagattaaagacccttgctgcgctggta
gatcactgccaaggacggaaggggggtgagctggcctctgctgttcacgcctacacaaag
acaggggacccctacatgaagtccctggtgcagcacattctgagcttagtgtctcaccct
gtcctgagcttcctctaccgatggatatacgacggggagttggaggacacttaccatgaa
ttttttgtggcgtcagatccaacagttaaaaccgaccgtctgtggcatgacaagtacacc
ctgaggaaatcaatgatcccttcctttattacgatggaccagtctaggaaggtccttttg
ataggaaagtcaataaatttcttgcaccaagtttgtcatgatcagacacctactacaaaa
atgatagctgtgaccaagtcggcagagtcacctcgtgacgctgcggacttattcacagac
ttagaaaatgcatttcaagggaaaattgatgctgcttattttgagaccagcaaatacctg
ttggatgtcctcaacagaaagtacagtctgctggagcacatgcaggccatgcgccggtac
ctgctgcttggccaaggagacttcatacggcacctaatggatctgctaaagtctctcctg
gtgacactgggtgggatgtcttcagcctggattaccacgtcgacggaccaattgccactg
tgttcacacgagagtgcatga

DBGET integrated database retrieval system