KEGG   Rattus norvegicus (rat): 306619Help
Entry
306619            CDS       T01003                                 

Gene name
Cln8
Definition
(RefSeq) ceroid-lipofuscinosis, neuronal 8
  KO
K12360  ceroid-lipofuscinosis neuronal protein 8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    306619 (Cln8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8
Motif
Other DBs
NCBI-GeneID: 306619
NCBI-ProteinID: NP_001007687
RGD: 1359518
Ensembl: ENSRNOG00000012565
UniProt: Q6AYM9
Position
16q12.5
AA seq 288 aa AA seqDB search
MTPVSNHGVAESIFDLDYASWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLLAKE
KVFWNLAATRAVFGIQSTAAGLWALLGDPVLYSNKALGQQNWCWFHITTATGFFFFENAA
VHLSNLFFRTFDLFLVVHHLFAFLGFLGSAVNLRAGHYLAMTTLLLEMSTPFTCVSWMLL
KAGWSHSLFWKVNQWLMIHMFHCRMILTYHMWWVCFQHWDALASSLYLPHLALFLFGLAL
LTVIINPYWTHKKTQQLLNPVDWNFAQPEAKGDRQERTNGQVPRKKRL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgtgagcaaccatggcgttgcggagagcatttttgacctggactatgcttcc
tggaagattcgatcaactctagcagtagctggctttgtcttctacctgggcgtctttgtg
gtctgccaccagctttcgtcctccctgaatgccacctaccgctctctgttggccaaagag
aaggtcttctggaacctggctgcgacgcgcgctgtcttcggcatccagagcacagccgca
ggcctgtgggcgctgctgggagaccccgtgctctactctaacaaggctctcgggcagcag
aactggtgctggttccacatcaccactgccacgggattcttcttcttcgagaatgcggcc
gttcacctgtccaacctgttcttccgtacttttgacctgtttctggtcgtccaccacctc
tttgcctttcttgggttccttgggtcagcggtcaatctcagagctggccactacctagcc
atgaccactttgctcctagagatgagcacgcccttcacctgcgtttcctggatgctcctg
aaggctggctggtcacactccctgttctggaaggtgaaccagtggctgatgatccacatg
tttcactgcagaatgatccttacctaccacatgtggtgggtgtgcttccagcactgggac
gccctcgccagcagcctgtacctgccccacttggcgctgttcctcttcgggctggccctg
ctcacagtcatcattaacccttactggacacacaagaagacccagcagcttctcaatccc
gtggattggaactttgcacagccggaagccaagggcgaccggcaagaaaggaccaatggc
caggtgcctcggaaaaagaggctgtag

DBGET integrated database retrieval system