KEGG   Rattus norvegicus (rat): 306748Help
Entry
306748            CDS       T01003                                 

Gene name
Cxcl14, BRAK
Definition
(RefSeq) C-X-C motif chemokine ligand 14
  KO
K10033  C-X-C motif chemokine 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    306748 (Cxcl14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    306748 (Cxcl14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    306748 (Cxcl14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    306748 (Cxcl14)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   306748 (Cxcl14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 NinB
Motif
Other DBs
NCBI-GeneID: 306748
NCBI-ProteinID: NP_001013155
RGD: 1307406
Ensembl: ENSRNOG00000011984
UniProt: Q8K453
Position
17p14
AA seq 99 aa AA seqDB search
MRLLAAALLLLLLALCASRVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT
KSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcctggcggccgcgctgctcctgctgctcctggcgctgtgcgcctcgcgcgtg
gacgggtccaagtgtaagtgttcccggaaggggcccaagatccgctacagcgacgtgaag
aagctggaaatgaagccaaagtacccacactgcgaggagaagatggttatcataaccacc
aagagcatgtccaggtaccgcggccaggagcactgcctgcatcctaagctgcaaagtacc
aagcgcttcatcaaatggtacaacgcctggaacgagaaacgcagggtctacgaagagtag

DBGET integrated database retrieval system