KEGG   Rattus norvegicus (rat): 306771Help
Entry
306771            CDS       T01003                                 

Gene name
Tspan17, Fbxo23, GHB-R
Definition
(RefSeq) tetraspanin 17
  KO
K10303  F-box protein 23
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    306771 (Tspan17)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     306771 (Tspan17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF2976
Motif
Other DBs
NCBI-GeneID: 306771
NCBI-ProteinID: NP_001013156
RGD: 1311167
Ensembl: ENSRNOG00000018122
UniProt: Q4V8E0
Position
17p14
AA seq 270 aa AA seqDB search
MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISGLTDLGG
LDPVWLFVVIGGIMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW
IRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE
RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAG
VLVAIALLQICGICLAQNLVSDIEAVKANW
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaagcatcagcaattccaggaccctgaggttggctgctgcgggaaatacttt
ctgtttggcttcaacattgtcttctgggtgctgggagccctgttcctggccatcggcctc
tgggcctggggtgagaagggcgttctttccaacatctcagggctgacagatctaggcggt
cttgaccccgtgtggctgtttgtggtgattgggggaatcatgtcagtgctgggctttgcc
ggctgcattggggccctccgggaaaacaccttcctgctcaaatttttctctgtgttcctc
ggcctcatcttcttcctggagctggcggccgggatcctggccttcgtgttcaaggattgg
atccgagaccaacttaacctcttcatcaacaacaatgtcaaagcctaccgggacgatatt
gaccttcagaaccttatcgactttgctcaggaatactggtcttgctgtggagcccgaggg
cccaatgactggaacctcaacatctacttcaactgcactgacttgaacccaagccgcgag
cgctgtggggtgcccttctcctgctgtgttagggaccctgcggaagacgtcctcaatacc
cagtgtggctatgacatccgactcaaactggagctggagcagcaaggctccatctacacc
aaaggctgcgtgggccagtttgagaagtggctccaagataacctgattgtggtggccggg
gtcttggtggccattgccctcctccagatatgtggcatctgcttggcccagaacctcgtg
agtgacatcgaggcagtaaaggccaactggtga

DBGET integrated database retrieval system