KEGG   Rattus norvegicus (rat): 306782
Entry
306782            CDS       T01003                                 

Gene name
Ror2
Definition
(RefSeq) receptor tyrosine kinase-like orphan receptor 2
  KO
K05123  receptor tyrosine kinase-like orphan receptor 2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    306782 (Ror2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    306782 (Ror2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     306782 (Ror2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  ROR family
   306782 (Ror2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kringle I-set Ig_3 Fz Ig_2 ig V-set C2-set_2 DUF2149
Other DBs
NCBI-GeneID: 306782
NCBI-ProteinID: NP_001100809
RGD: 1305275
Ensembl: ENSRNOG00000053232
UniProt: D3ZNY8
Position
17p14
AA seq 943 aa
MARGWVRPSRVPLCVRAVWTAAALLLWTPWTAGEVEDSEAIDTLGQLDGPDSPLPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGLKTITATGVLYVRLGPTHSPNHNFQDDDQEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRAPKPRELCRDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGTDYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRVELCDVPPCSPRDGSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLISQHKQAKLKEISLSTVRFMEELG
EDRFGKVYKGHLFGPAPGEPTQVVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLL
GVVTKDQPLSMVFSYCCHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIA
AGMEFLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSLLPIRWMS
PEAVMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAW
VYALMIECWNEFPSGRPRFKDIHGRLRSWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYMAPKQKAQPFPQPQFIPMKGQIRPLVPPAQLYIPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDVQNM
PEDVAQSPVQEAEEEEEGSVPETELLGDSDTLQVNEAHVHLEA
NT seq 2832 nt   +upstreamnt  +downstreamnt
atggctcggggctgggtgcggccgagccgagtgcctctgtgcgtccgggctgtctggacg
gctgctgcgctcctgctctggacaccctggacggcaggtgaagtggaggactcagaggcc
attgacaccttgggacaacttgatggcccggacagcccacttcccactctgaaaggctac
tttctgaattttctggagcccgtcaacaatatcaccatcgtccagggccagacggcaatt
ctgcactgcaaggtggcgggaaacccacctcccaacgtgcggtggctgaagaatgatgcc
cctgtcgtacaggagccacggagggtcatcatccggaagacagaatatggctcccggctg
cggatccaggatctggacacgacagacacgggctactaccagtgcgtggctaccaacggg
ctgaagaccattaccgccactggtgttctgtatgtgcggctcggtccaacgcacagcccg
aaccacaattttcaggatgacgaccaggaagatggcttctgccaaccttaccgagggatc
gcctgtgcacgcttcattgggaaccgaactatttatgtggactccctccagatgcagggg
gagattgaaaaccgaatcacagctgccttcaccatgattggcacctccacgcacctgtca
gaccagtgctcgcagtttgccatcccatccttctgccacttcgtctttcctctatgcgac
gcgcgctcccgggcgcccaagccgcgggagctgtgccgggatgaatgtgaggtgttggag
aatgacctgtgccgccaggagtacaccatcgcccgctccaaccctctcatcctcatgcgg
ctccagctgcccaagtgcgaagcgctgcccatgcccgagagccctgatgctgcgaactgc
atgcgcatcgggatccccgccgagaggctgggtcgctatcaccagtgttacaacggctca
ggcactgattacaggggcatggccagcaccaccaagtcaggccaccaatgtcagccttgg
gctctgcaacatccccacagccatcgcctgtccagcacagaatttccagagctgggagga
ggccacgcctactgccggaacccgggaggccagatggaaggcccgtggtgctttacgcag
aataaaaacgtacgagtggaactgtgtgacgtacccccatgtagtccccgagacggcagc
aagatggggatcctgtacatcctggtccccagcattgccatccccctggtcatcgcctgc
cttttcttccttgtctgcatgtgccggaacaagcagaaggcctcagcctccaccccgcag
cgccggcagctgatggcctcgcccagccaggatatggagatgccactcatcagccagcac
aaacaggccaaacttaaagagatcagcttgtccacggtgaggttcatggaggagcttggg
gaggaccggtttggcaaggtctacaaaggccacctgttcgggcccgccccaggagaacca
acccaggtggtggccatcaagacgttgaaagacaaggctgaggggcccctgcgggaggag
ttccggcaagaggccatgctccgggcacggctacagcaccccaacatcgtctgtctacta
ggtgtggtgaccaaagaccaacccctgagcatggtcttcagttactgctgccacggcgac
ctccacgagttcctggtcatgcgctcaccgcactcggacgtgggcagcactgacgatgac
cgcacggtgaagtcagccctggagcccccggacttcgttcacgtggtggcgcagatcgcc
gcggggatggagttcctgtccagccaccacgtggtccataaggacctggccacccgtaat
gtgctggtgtatgacaagctgaacgtgaggatctcagacttgggcctcttccgagaggtg
tactccgccgattactacaaactcatgggcaactcgctgcttcccatccgctggatgtcc
cccgaggccgtcatgtacggaaagttctccattgactccgacatctggtcctatggtgtg
gtcctctgggaggtcttcagctacggcctgcagccctactgtggctactccaaccaggac
gtggtggagatgatccgtagccggcaggtactgccctgcccggatgactgccccgcctgg
gtctacgccctcatgatcgaatgctggaacgagtttcctagcgggaggccccgctttaag
gacatccacggccggctccgatcctggggcaacctgtccaactacaatagctcggcccag
acctcaggagccagcaacaccacacagaccagctccctgagcaccagccctgttagcaat
gtgagcaatgcccgctatatggcacctaagcagaaggcccagcccttcccacagcctcag
ttcatccccatgaagggtcagatcagacccttggtgcccccggcacagctctacatccca
gttaatggctaccagccagtaccggcatatggggcctacctgcccaacttctacccggtc
caaatccccatgcagatggccccacagcaggtgccccctcagatggtccccaagcccagc
tcacaccacagtggcagcggctccaccagcactggctatgtcaccacggcaccctctaac
acatctgtggcggacagggcagccctcctctcggagggcactgaggatgtacaaaacatg
ccagaagacgtggcccagagccctgtgcaggaagcggaggaggaggaggaaggttctgtc
ccagagactgagctcctgggagacagtgacacgctccaggtgaacgaggcccatgtccac
cttgaagcctga

DBGET integrated database retrieval system