KEGG   Rattus norvegicus (rat): 306790
Entry
306790            CDS       T01003                                 

Gene name
Sema4d
Definition
(RefSeq) semaphorin 4D
  KO
K06521  semaphorin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    306790 (Sema4d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    306790 (Sema4d)
CD molecules [BR:rno04090]
 Proteins
  306790 (Sema4d)
SSDB
Motif
Pfam: Sema PSI ig Ig_3 I-set DUF3891 Thyroglob_assoc
Other DBs
NCBI-GeneID: 306790
NCBI-ProteinID: NP_001164034
RGD: 1310554
Ensembl: ENSRNOG00000013679
Position
17p14
AA seq 862 aa
MKMCAPVRGLFLALVAVWRTAVAFAPVPRITWEHGEVGLVKFHEPGIFNYSSLLMSEDKD
TLYVGAREAVFAVNALDISEKQHEVYWKVSEDKKSKCAEKGKSKQTECLNYIRVLQPLSS
TSLYVCGTNAFQPTCDHLNLTSFKFLGKSEDGKGRCPFDPAHSYTSVMVGGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIHKSPDGTEAEDDKVYFFFTEVSV
EYEFVFKLMIPRVARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNILQDVFVLR
APGLKEPVFYAVFTPQLNNVGLSAVCAYTLSTVEAVFSRGKYMQSATVEQSHTKWVRYNG
PVPTPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNY
TQIVVDRTQALDGTFYDVMFLSTDRGALHKAVILAKEVHVVEETQLFQDFEPVLSLLLSS
KKGRKFVYAGSNSGVVQAPLAFCGKHSSCEDCVLARDPYCAWSPAIKACVTLHQAEGSSR
GWIQDMSGDTSSCLDKSKESFHQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAVSPK
YGFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVSQLLAKHILEVKMVARIPPSPTSQT
AQTEGSRITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSTGTSCEPKMVINTVPQL
HSEKTVYLKSSDNRLLMSLLLFLFVLFLCLFSYNCYKGYLPGQCLKFRSALLLAKKKPKS
EFSDLEQSVKETLVEPGSFSQQNGDQPKPALDTGYETEQDTITSKVPTDREDSQRIDELS
ARDKPFDVKCELKFADSDADGD
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgaagatgtgtgcccccgtcagggggctgttcttggccctggtggctgtgtggaggacc
gcggtggcattcgcccctgtgcctcggatcacctgggagcacggagaggtaggtctggtg
aagtttcacgagccaggcatctttaactactcttccttgctgatgagtgaagacaaagac
actctgtatgtgggtgcccgggaagctgtctttgcagtgaatgcgctggacatctctgag
aagcaacatgaggtatactggaaggtctctgaagacaaaaaatccaagtgcgcagagaag
gggaaatcaaagcagacggagtgccttaactacatccgagtgctgcaaccgcttagcagc
acttccctctacgtgtgtgggaccaatgcgttccagcccacctgtgaccacctgaacttg
acctctttcaagtttctggggaaaagcgaagatggcaaaggaagatgccccttcgacccc
gcccatagctacacatccgtcatggtcgggggagagctctactctgggacttcatataat
ttcttgggcagcgaacccatcatctctcgaaactcttcccacagtcccctgaggacagag
tacgccatcccttggctaaacgagcctagcttcgtctttgctgacgtgatccacaagagc
ccagatggtacagaggctgaggatgacaaggtctacttcttctttacggaggtgtccgtg
gagtacgagttcgtcttcaagttgatgatcccgcgagttgccagggtgtgcaagggcgac
cagggcggcctgcggactttgcaaaaaaagtggacctccttcctaaaggccagactgatc
tgctccaggccagacagtggcctggtcttcaacattcttcaagatgtgtttgtgctgagg
gccccgggcctcaaggaacctgtgttctatgcggtcttcaccccacagctgaacaacgtg
ggtctgtcagcggtctgtgcctacacgctgtccacggtggaggccgtcttctcccgagga
aagtacatgcagagtgccacagtggagcagtctcacaccaagtgggtacgctacaatggc
ccagtgcccactccccggcctggagcgtgtatcgacagtgaggcccgggcagccaactac
accagctccttgaatctcccagacaaaacgctgcagtttgtcaaagaccaccctttgatg
gacgactcggtgacgccaatagacaacaggccgaaactgatcaaaaaagatgtcaactac
acccagatagtggtagacaggacccaggccctggatgggaccttctacgacgtcatgttc
ctcagcacagaccggggcgctctgcataaagctgtcatccttgcaaaagaggtacacgtg
gttgaggagacccaactcttccaggacttcgaaccggtcctgtctctgctgctatcatca
aagaaggggaggaagtttgtctatgctggctccaactcaggagtggtccaagctcccctg
gccttctgcggaaagcacagtagctgtgaagactgtgtgctagcacgggacccctactgc
gcctggagcccagccatcaaggcctgtgttaccttgcaccaggcagagggctctagcagg
ggctggattcaggacatgagtggcgacacgtcctcgtgcctggataagagtaaagaaagt
ttccatcagcattttttcaagcacggcggcacagcagaactcaagtgtttccaaaagtcc
aacctggcccgggtggtgtggaagttccagaacggcgagttgaaggctgtgagtcccaag
tatggctttgtgggcaggaagcacctgctcatctttaacctgtcagacggagacagcggt
gtgtaccagtgcctgtcagaggaaagggtcaggaataaaacggtctcccagctgctcgcc
aagcacatcctggaagtgaaaatggtagctcggatccccccatcacctacctcacagact
gctcagacagaaggtagtaggatcacatccaaaatgcctgtggcgtctacccaggggtcc
tctccccctaccccggctctgtgggcaacctcccccagggctgccaccctacctcccaag
tcctcctccaccggcacgtcctgtgaaccaaaaatggtcatcaacacggtcccacagctc
cactcggagaagacagtgtatctcaagtccagtgacaaccgcctgctcatgtctctcctc
ctcttcctctttgtcctcttcctctgcctcttttcctacaactgctacaagggctacctg
cccggacagtgcttaaagttccgctcagccctgctgctcgcaaagaaaaaacccaagtca
gagttctctgacctggagcagagtgtgaaggagacgctggtagaacctgggagcttctcg
cagcagaacggcgaccagcccaagccagccttggataccggctatgaaaccgagcaggac
actatcaccagcaaggtccccaccgatcgagaggactcgcaacgtatcgacgagctctcc
gccagggacaaaccgtttgatgtcaagtgtgaactcaagtttgcagactcggatgccgac
ggggactga

DBGET integrated database retrieval system