KEGG   Rattus norvegicus (rat): 306792
Entry
306792            CDS       T01003                                 

Gene name
S1pr3, Edg3, Edg3l, lpb3
Definition
(RefSeq) sphingosine-1-phosphate receptor 3
  KO
K04290  sphingosine 1-phosphate receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    306792 (S1pr3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    306792 (S1pr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    306792 (S1pr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    306792 (S1pr3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Tetraspanin DUF5652
Other DBs
NCBI-GeneID: 306792
NCBI-ProteinID: NP_001258072
RGD: 1583843
Ensembl: ENSRNOG00000014524
UniProt: F1M9D3
Position
17p14
AA seq 379 aa
MASTHAQGHPPVLGNDTLREHYDYVGKLAGRLRDPPEGSTLITTILFLVTCSFIVLENLM
VLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGRKTFSLSPTVWFLREGSMF
VALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCWLIAFSLGALPILGWNCL
ENFPDCSTILPLYSKKYIAFLISIFTAILVTIVILYARIYFLVKSSSRRVANHNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRAKECSILFKSQWFIMLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCGCLVKGKGTQASPMQPALDPSRSKSSSSNNSSSHSPKVKEDLPHVA
TSSCVTDKTRSLQNGVLCK
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcatccacgcatgcgcagggccacccgccagtcttggggaatgatactctccgggaa
cattatgattacgtggggaagctggcaggcaggctgcgggacccccctgagggtagcacc
ctcatcaccaccatcctcttcttggtcacctgtagcttcatcgtcttggagaacctgatg
gttttgattgccatctggaaaaacaataaatttcataaccgcatgtactttttcatcggc
aacttggctctctgcgacctgctggccggcatagcctacaaggtcaacattctgatgtcc
ggtaggaagacgttcagcctgtctccaacagtgtggttcctcagggagggcagtatgttc
gtagccctgggcgcatccacatgcagcttattggccattgccattgagcggcacctgacc
atgatcaagatgaggccgtacgacgccaacaagaagcaccgcgtgttccttctgattggg
atgtgctggctaattgccttctcgctgggtgccctgcccatcctgggctggaactgcctg
gagaactttcccgactgctctaccatcttgcccctctactccaagaaatacattgccttt
ctcatcagcatcttcacagccattctggtgaccatcgtcatcttgtacgcgcgcatctac
ttcctggtcaagtccagcagccgcagggtggccaaccacaactccgagagatccatggcc
cttctgcggaccgtagtgatcgtggtgagcgtgttcatcgcctgttggtccccccttttc
atcctcttcctcatcgatgtggcctgcagggcgaaggagtgctccatcctcttcaagagt
cagtggttcatcatgctggctgtcctcaactcggccatgaaccctgtcatctacacgctg
gccagcaaagagatgcggcgtgctttcttccggttggtgtgcggctgtctggtcaagggc
aaggggacccaggcctccccgatgcagcctgctcttgacccgagcagaagtaaatcaagc
tccagtaacaacagcagcagccactctccaaaggtcaaggaagacctgccccatgtggct
acctcttcctgcgtcactgacaaaacgaggtcgcttcagaatggggtcctctgcaagtga

DBGET integrated database retrieval system