KEGG   Rattus norvegicus (rat): 306809Help
Entry
306809            CDS       T01003                                 

Gene name
Bicd2
Definition
(RefSeq) BICD cargo adaptor 2
  KO
K18739  protein bicaudal D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    306809 (Bicd2)
   04131 Membrane trafficking [BR:rno04131]
    306809 (Bicd2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     306809 (Bicd2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    306809 (Bicd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BicD DUF1796
Motif
Other DBs
NCBI-GeneID: 306809
NCBI-ProteinID: NP_001028846
RGD: 735093
Ensembl: ENSRNOG00000016031
UniProt: Q496Z1
Position
17p14
AA seq 851 aa AA seqDB search
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQ
FEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLE
LQTELKQLRNVLINTQSENERLTSVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQD
YSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQL
EEALETLKTEREQKNNLRKELSHYMSINDSFYTSHLQVSLDGLKFSDDAVTAEPNNDAEA
LVNGFEHSGLVKASLDNKTSTPRKDGLAPPSPSLVSDLLSELHISEIQKLKQQLVQMERE
KVGLLATLQDTQKQLEQARGTLSEQHEKVSRLTENLSALRRLQAGKERQTSLDNEKDRDS
HEDGDYYEVDINGPEILSCKYHVAVAEAGELREQLKALHSTHEAREAQLAEEKGRYEAEV
QALTEKVSLLEKASHQDQELLAQLEKELRKVSDVAGETQGSLNVAQDELVTFSEELANLY
HHVCMCNNETPNRVMLDYYREGQGKAGRTSPEGRGRRSPVLLPKGLLSTEIGRADGGTGD
NSPSPSSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPA
VDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTE
TMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRM
AIQQKLALTQRLELLELDHEQTRRGRNKATSKAKPATPSVSHTCACASERAEGTGLANQV
FCSEKHSIYCD
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccgtcggaggaggaggagtatgcgcgtctggtgatggaggcgcagccggag
tggctgcgcgccgaggtgaagcgactgtcccacgagctggccgaaaccacgcgtgagaag
atccaggcggccgagtatggactggcggtgcttgaggagaagcaccagctcaagctgcag
ttcgaggagctcgaggtggactatgaggccatccgcagcgagatggagcagctcaaagag
gcatttggccaggcacacacaaaccacaagaaggtggctgctgatggagagagccgggag
gagagcctgatccaggagtccgcctctaaggagcagtactatgtgcggaaggtgctggag
ctgcagacagagctgaaacagctgcgcaatgtccttatcaacactcagtctgagaatgag
cgcctcacgtctgtggcccaggagctgaaagagatcaaccagaatgtggagattcagcgt
ggtcgcctgcgagatgacatcaaggagtacaagttccgggaggcccgtctacttcaggac
tactctgagctggaggaggagaacattagcctgcagaaacaagtgtctgtgctcaggcag
aaccaggtggaatttgagggcctcaagcatgaaatcaagcgtctggaggaggagacagag
taccttaacagccagctggaggatgccatccggcttaaggagatctctgaacggcagttg
gaggaagcgctggagacgttgaagacagagcgagagcagaagaacaacctacgtaaggag
ttgtcgcactacatgagcatcaacgattccttctataccagccacctgcaggtatcctta
gatggcctcaagttcagtgatgatgctgtcactgctgagcccaacaacgacgccgaagcc
ctggtcaatggctttgagcacagcggcttggtcaaagcgtcgttggacaacaagacatcc
acacccagaaaggatggcctggctccgccctcccccagccttgtttccgacctgctcagt
gagctccacatatctgagatccagaagctgaagcagcagctggtgcagatggagcgggag
aaggtgggtctgctggcgacattacaggacacacagaagcagctagagcaggctcgggga
accctctctgagcaacatgagaaggtgagtcgtctcacagagaaccttagtgccctccgg
cgcctgcaggctggcaaggagcgacagacttccctggataacgaaaaggaccgagatagc
catgaagacggtgactactatgaggttgacatcaatgggcctgagatcctgtcctgcaag
taccatgtagctgtggccgaggctggcgagctccgggagcagctcaaggccctgcacagc
acacatgaagctcgggaagcccagcttgcagaagaaaagggccgctatgaggctgaggtc
caggctctcactgagaaggtgtcactgctggagaaggctagccaccaggaccaagagctg
ctggcccagctggaaaaggagctgaggaaggtgagtgacgtggctggtgagacccagggc
agcctgaatgtggctcaggatgagttggtgaccttcagcgaggagctggccaatctctac
caccatgtgtgcatgtgcaacaacgagacacccaaccgtgtcatgctggactattaccgt
gaggggcagggcaaggctggccgcaccagcccagaaggccgcgggcgccgctcgcctgtc
cttttgcccaaggggctgttgtcgacagagatcggccgagcagatggtgggactggggac
aacagcccttcacccagctcttcactgccatcaccattgagtgacccccgccgggaacct
atgaacatctacaacctgatcgccatcatccgagaccagatcaagcacctgcaggcagcc
gtagatcgtacaaccgagctgtcccggcagcggattgcctcacaggagctgggccctgct
gtggataaggacaaggaagcactcatggaggagatcctcaagctgaagtcactgctgagt
accaagagggaacagatcaccacacttcgtactgtgctcaaggctaacaagcagacggca
gaggtggccctcgccaacctgaagagcaagtatgagaatgagaaggccatggtgaccgag
accatgatgaagctgcggaacgagctgaaggccctcaaggaggacgcagccaccttctcc
tccctgcgtgccatgttcgccaccaggtgtgatgagtacatcacgcagctggatgagatg
cagcggcagctggcggctgccgaggatgagaagaagactcttaattccctgctgcgcatg
gccatccagcagaagctggcactcacccagcggctggagctgctggagctggaccatgag
cagacccgcaggggccgtaacaaggccacctccaaggccaagccagccacaccgagcgta
agtcacacctgcgcctgtgccagcgagagggcggagggcaccgggctggccaaccaggtg
ttctgcagcgagaagcacagcatttactgtgattag

DBGET integrated database retrieval system