KEGG   Rattus norvegicus (rat): 306814Help
Entry
306814            CDS       T01003                                 

Gene name
Phf2
Definition
(RefSeq) PHD finger protein 2
  KO
K19414  lysine-specific demethylase PHF2 [EC:1.14.11.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306814 (Phf2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     306814 (Phf2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    306814 (Phf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JHD JmjC Cupin_8
Motif
Other DBs
NCBI-GeneID: 306814
NCBI-ProteinID: NP_001100812
RGD: 1305228
Ensembl: ENSRNOG00000016816
UniProt: F1LWX5
Position
17p14
AA seq 979 aa AA seqDB search
MEEHGFTEPILVPKKDGLGLAVPAPTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEF
VDYYYSTNRKRVLNVTNLEFSDTRMSSFVEPPDIVKKLSWVENYWPDDALLAKPKVTKYC
LICVKDSYTDFHIDSGGASAWYHVLKGEKIFYLIRPASANLSLYECWRSASNHSEMFFAD
QVDKCYKCTVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKL
GSLTQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAE
HEDELPEHFRPSQLIKDLAKEIRLSENASKTVRPEVNAVASSDEVCDGDREKEEPPSPIE
STPPRSLLEKVSKKKTSKTVKMPKPSKTPKPPKPPKPPKTLKLKDGSKKKGKKCKESASP
TIPNLDLLEAHTKEALTKMEPPKKGKTPKSVLSVPNKDTVHTQNDVERLEIREQTKSKSE
AKWKYKNSKPDSLLRMEEEQRLEKSPLAGNKDKFSFSFSNRKLLGSKPLRPPSSPGVFGT
LQSFKEDKAKPVRDEYEYVSDDGELKIDEFPIRRKKNPPKRDLSFLLDKKETLLIPTSKP
KLDSTAYKSDDSSDEGSLHIDTDTKPSRNAKVKKESGSSAAGILDLLQASEEVGALEYNP
NSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGTGQAKGGSLAAHGARKNGGSSKGTG
KRLLKRTAKNSVDLEDYEEQDHLDACFKDSDYVYPSLESDEDNPVFKSRSKKRKGSDDAP
YSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKNRKKKNTKRKPTPNT
ASPSVSTSASASTGTTSASTTPASTTPASTTPASTTPASTSTASSQASQEGSSPEPPPES
HSSGLADHEYTAAGTFAGAQAGRASQPMAPGVFLTQRRPSASSPNNTAAKGKRTKKGMAT
AKQRLGKILKIHRNGKLLL
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcatggcttcaccgagcccatccttgtccccaagaaagatggcctgggcttg
gctgtccctgccccaacattctacgtgagtgacgtggagaactatgtggggccagagagg
agtgtggacgtgacagacgttaccaagcagaaagactgcaaaatgaagctgaaagaattc
gtggactattactacagcaccaaccgcaaacgtgttctcaatgtgaccaacctcgagttc
tcagacaccagaatgtccagctttgtggagccacctgacattgtgaagaaactatcgtgg
gtggaaaactactggcccgatgacgcgctgctggccaagcccaaggtgaccaagtactgc
ctgatctgtgtgaaggacagctacaccgacttccacattgattctggaggtgcctcagcc
tggtaccacgttctcaagggggagaagatcttctatctcatccggccggcctcagccaac
ctctccctatatgaatgctggcggtcagcctccaaccacagcgagatgttctttgctgac
caggtggacaagtgctataagtgcactgtcaagcagggccagaccctcttcatcccctca
ggctggatatacgctacgctcacccctgtggactgcctggccttcgctggacattttctt
cacagcctcagtgtggagatgcagatgagggcatacgaggtggaaagaaggttaaaacta
ggcagcctgactcaatttcccaactttgaaactgcctgctggtacatggggaagcatcta
ttggaagcattcaaaggttctcacaagtctgggaaacagctgcccccacacttagttcaa
ggagctaagattctcaatggtgcttttaggtcatggacgaagaagcaggctttggcagag
cacgaggacgagctcccggagcacttcaggccctcacagctcatcaaggacctggccaaa
gagatcaggctcagcgagaatgcctccaaaactgtccgacctgaagtaaatgctgtcgcc
tcctcagatgaggtctgtgacggggaccgggagaaggaggaaccgccatctcccattgag
tctaccccacctcgatccctcctggagaaagtgtccaaaaaaaagacttccaagactgtg
aagatgcccaagccatccaaaacccccaagccccccaagccccccaagccccccaaaacc
ctgaaactcaaggacggaagcaagaagaaagggaagaagtgcaaagagtccgcctctccc
accatccccaacttggacctgcttgaggcccacaccaaggaggcgctgaccaagatggag
ccaccgaagaaaggaaagactccaaagagcgtcctgagtgttcccaataaggacacggtc
cacacgcagaatgacgtggaaagactggaaatccgagagcaaacaaagagcaagtcggag
gccaagtggaagtacaagaacagcaaacctgactctttactgagaatggaggaggagcag
aggttggagaagtcacccctggctgggaacaaggacaagttttccttttctttctctaac
agaaaactcctgggctccaagcccctcaggccgccgagcagccctggcgtgttcgggacc
ttgcagagcttcaaggaggacaaggccaagcccgtccgagatgagtatgaatatgtatcg
gacgacggggagctgaagattgacgagtttcctatcaggaggaagaagaacccccccaaa
agggatttgtcctttttgttagacaagaaggagactctcctcatccccacctcgaagcca
aagctggactccacggcatacaagagcgacgactcctctgatgagggctctctgcatatc
gacacggacaccaagccaagccgaaatgccaaagtgaagaaggaaagtgggagctcggcg
gcaggcatcctggacctactgcaggccagcgaggaggtcggggctcttgagtacaacccc
aacagccagccccctgcctcccccagtacgcaggaagccattcagggaatgttgtccatg
gccaatctgcaggcctctgactcctgcctgcagaccacatggggcactggccaggccaag
gggggttccctggcagcccatggcgcccggaagaatggtggtagcagcaaagggacaggc
aagcgcctactgaagaggactgccaagaacagcgtggatcttgaggactatgaggagcag
gaccacctggacgcctgcttcaaggactcagactatgtttacccctcactggagtctgac
gaagataaccctgtcttcaagtcccggtcaaagaagaggaaaggctcagacgatgctcct
tacagccccacagccagggtcggtccatcagtgccgagacaagacaggcctgtgcgtgag
gggaccagagtggcctccattgagactgggctggcagctgctgcagccaagctgtcccag
caggaggagcagaaaaacaggaagaagaagaacaccaaaaggaagccgactcctaacact
gcctccccctccgtctccacgtctgcctccgcctccacgggtaccacctcggcctccacc
accccagcctccaccaccccggcctccaccaccccagcatccaccaccccggcctctacc
agcacagccagcagccaggcctcacaggagggcagctcacccgagcccccacctgagtca
cacagcagtggcctagctgaccacgagtatacagcagccggcacattcgcaggggcccag
gctggccgtgcctcccagcccatggcccctggagtctttctcacacagaggcggccttct
gcatcatcccccaacaacactgctgccaaaggaaaacgtacaaaaaagggcatggccacc
gccaagcaaaggcttggaaagatcttgaagatccatcggaatgggaaactgctcctctaa

DBGET integrated database retrieval system