KEGG   Rattus norvegicus (rat): 306819Help
Entry
306819            CDS       T01003                                 

Gene name
Kdm1b, Aof1
Definition
(RefSeq) lysine demethylase 1B
  KO
K19413  lysine-specific histone demethylase 1B [EC:1.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    306819 (Kdm1b)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     306819 (Kdm1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    306819 (Kdm1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 zf-CW Pyr_redox Pyr_redox_2 SWIRM Thi4 HI0933_like Pyr_redox_3 DAO FAD_binding_3 FAD_binding_2 NAD_binding_9 Lycopene_cycl FAD_oxidored 2-Hacid_dh_C GIDA AlaDh_PNT_C NAD_binding_7 Attractin YjeF_N Shikimate_DH LcnG-beta IlvN zf-RING_2
Motif
Other DBs
NCBI-GeneID: 306819
NCBI-ProteinID: NP_001100813
RGD: 1310701
Ensembl: ENSRNOG00000016519
UniProt: D3ZP89
Position
17p14
AA seq 824 aa AA seqDB search
MAASRGRSKKRSNFELSPDTLPLRSSGRQAKKKAVEITEEDEDGSSEKKYRKCEKAGCTT
AYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTAWKRVWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPHMARTYRCGMKPNTITKPD
TPDHCSFPEDLRVLEVSNHWWYSMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRA
AVTATATGSASPGEMEPSKAAPASLVLGMNRYFQPFYQPNECGKALCVRPDVMELDELYE
FPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHVIVRGLVRIRCVQEVERILYFM
TRKGLINTGVLTVGAGQHLLPKHYHNKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAKDR
IGGRVWDDKSFKGVVVGRGPQIVNGCINNPVALMCEQLGIRMHKLGERCDLIQEGGRITD
PTIDKRMDFHFNALLDVVSEWRKDKTLLQDVPLGEKIEEIYRAFVKESGIQFSELEGQVL
QFHLSNLEYACGSSLHQVSARSWDHNEFFAQFAGDHTLLTPGYSTIVEKLAEGLDIRLKS
PVQSIDYTGDEVQVTTTDGVVHSAQKVLVTVPLAMLQRGAIQFNPPLSEKKMKAINSLGA
GIIEKIALQFPYRFWDSKVQGADFFGHVPPSASQRGLFAVFYDMGPQQSVLMSVITGEAV
ASLRTMDDKQVLQQCLGVLRELFKEQEIPDPTKYFVTRWNTEPWIQMAYSFVKTFGSGEA
YDIIAEEIQGTVYFAGEATNRHFPQTVTGAYLSGVREASKIAAF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatctcgagggcggtcaaagaagagaagcaatttcgagctttctcctgatacc
ctgcctttgaggagctccgggcgacaggcaaagaagaaggctgtagagatcacagaggag
gacgaggatggttcgtcggagaagaagtacagaaagtgtgaaaaggcaggctgtacaacg
gcgtatcctgtgtgctttgcaagcgcttctgagaggtgtgccaagaatggctacacctcc
cgatggtatcacctttcctgtggggaacacttctgcaacgaatgctttgaccactactac
agaagccacaaggatggatacgacaagtacactgcatggaagagagtgtggaccagcaac
ggcaagacggagcccagccccaaggcattcatggcagaccagcagctgccctactgggtt
cagtgcacaaaacccgagtgtagaaagtggaggcagcttaccaaggagatccagcttact
ccacacatggcgaggacgtaccgctgcggcatgaagccaaatactattaccaagcctgac
acccctgatcattgttctttccccgaggatctaagagtgctggaagtctccaaccactgg
tggtactccatgctcatccagcctccattgctgaaggacagtgtggcagccccgctgctc
tctgcctactacccggactgcgtgggcatgagcccctcctgtaccagtacacatcgtgcc
gccgtcacagccactgccaccggcagtgccagcccaggggagatggagccctccaaggca
gcccccgcttcgctcgttctaggcatgaaccggtatttccagccgttctaccagcccaac
gagtgcggcaaggccctgtgtgtgcggccagatgtgatggaactggatgagctctatgag
ttcccagagtactctcgggaccccaccatgtacctggctttgagaaacctcatcctcgct
ctgtggtatacaaactgcaaagaagctctcaccccacagaagtgcattccccatgtcatc
gtccggggccttgtacgcatccgatgtgttcaggaagtggagaggattctttatttcatg
acaaggaaaggcctcatcaacacgggagttctcaccgtgggagccggccagcatcttctt
cctaaacactaccataataaatctgttctggttgttggggctggtccagcaggcttagca
gctgctaggcaactacataactttgggatgaaggtgactgtcctggaagccaaagaccga
atcggaggccgtgtctgggatgacaagtcctttaaaggcgtggtagtaggaagaggaccc
cagattgtcaatggctgtattaataacccagtagcactgatgtgtgagcaacttggcatc
cgcatgcataagttgggagagagatgtgacttaattcaggaaggtggacggataactgac
cccactattgacaagcgcatggattttcattttaatgccctcttggatgttgtctctgag
tggaggaaggataagactctgctccaagatgtccctttaggagaaaagatagaggagatc
taccgagccttcgtgaaggagtctggcatccagttcagtgagctggagggacaggtgctg
cagttccacctgagtaacctggagtatgcgtgtggcagcagcctgcaccaggtgtctgct
cgctcctgggatcacaatgaattcttcgcccagtttgctggtgaccataccctcctaact
ccaggctactccacgatcgttgagaaactggctgaagggctagacattagactcaagtct
ccagtgcagagcatagattacactggagatgaagtgcaggtgaccacgacagatggcgtg
gtgcattccgcacaaaaggtattagtcaccgtgccattggccatgctacagagaggtgcc
atccagtttaacccaccgttgtcagagaaaaagatgaaggccatcaacagcttgggggca
ggcatcattgaaaagatcgccttgcagtttccatatagattttgggacagtaaagttcaa
ggtgctgacttttttggccacgttcctcccagtgccagccaacgagggctcttcgctgtg
ttctatgacatgggcccccagcagagtgtactgatgtcggtgatcacaggggaggcagtg
gcatccctcaggaccatggatgacaagcaggtgctgcagcagtgcctgggcgtccttcgg
gagctgttcaaggagcaggagatcccagatcccacaaagtattttgtcacacggtggaac
acagagccatggatccagatggcctatagctttgtgaagaccttcggaagtggcgaggcc
tatgacattattgctgaagaaatacaaggaactgtttactttgctggtgaggcaacaaac
aggcatttcccacaaactgttactggagcatatttgagtggtgttcgagaagcgagcaag
atcgcagccttttaa

DBGET integrated database retrieval system