KEGG   Rattus norvegicus (rat): 306844Help
Entry
306844            CDS       T01003                                 

Gene name
Phactr1
Definition
(RefSeq) phosphatase and actin regulator 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RPEL Sod_Ni FAP
Motif
Other DBs
NCBI-GeneID: 306844
NCBI-ProteinID: NP_999622
RGD: 1303187
UniProt: P62024
Position
17p13-p12
AA seq 580 aa AA seqDB search
MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQARRATLLLPPTLMAASSEDDIDRRPI
RRVRSKSDTPYLAEARISFNLGAAEEVERLAAMRSDSLVPGTHTPPIRRRSKFANLGRIF
KPWKWRKKKSEKFKHTSAALERKISMRQSREELIKRGVLKEIYDKDGELSISNEDDSLTN
GQSLSSSQLSLPALSEMEPVPMPRDPCSYEVLQASDIMDGPDPGAPVKLPCLPVKLSPPL
PPKKVLICMPVGGPELSLASYTAQKSSQQAVAQHHHTVLPSQMQHQLQYGSHGQHLPSST
GTLPMHPSGCRMIDELNKTLAMTMQRLESSEQRVPCSTSYHSSGLHSSDGVTKAGPLGLP
EIRQVPTVVIECDDNKENVPHEPDYEDSSCLYAREEEEEEEDEDDDASLYTSSLAMKVCR
KDSLAIKLSNRPSKRELEEKNILPRQTDEERLELRQQIGTKLTRRLSQRPTAEELEQRNI
LKPRNEQEEQEEKREIKRRLTRKLSQRPTVEELRERKILIRFSDYVEVADAQDYDRRADK
PWTRLTAADKAAIRKELNEFKSTEMEVHELSRHLTRFHRP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggattatcccaaaatggattattttctggacgttgagtcggctcacagactcctggat
gtggagtcagcacagagattcttctatagccaaggagctcaagctcgccgggcgaccctg
ctcctgcctcccacattaatggcggcttcttcggaggatgacatagaccggcggcccatc
agaagagtccgctccaagagcgacacgccatatctcgcagaggccaggatctcctttaac
ctgggggcagctgaggaagtggaaaggctggcggccatgcgctctgactcgttggtccca
ggtacgcacaccccgcccatccggaggaggagtaagtttgccaacctgggaaggattttc
aagccttggaaatggaggaagaagaaaagcgaaaagttcaagcacacgtcagcagctctg
gaaaggaagatatcgatgaggcagagcagagaggagctgatcaagcgaggggtcttgaag
gagatctacgataaagatggagagctctccatatcaaatgaagatgactccctcacaaac
ggccagtccctgagctccagccagctctctttgcctgctctgtcggaaatggagcctgtc
ccaatgcccagggacccctgctcatatgaggtgctccaagcttcagacattatggatgga
ccagatcctggcgcccccgtgaaattgccttgtctgccagtgaaactgtcgcctccgcta
cctccaaagaaagtcctgatctgcatgcctgtagggggcccagagctctccctggcatcc
tacacagcccagaagagcagccagcaggctgtggcccagcaccaccacaccgtcctgcca
tcccagatgcagcaccagctgcagtatggcagccacggccagcatctcccgtcctccacc
ggcaccttacccatgcacccctcgggctgcaggatgatcgatgagctgaacaagacactt
gctatgaccatgcagaggctggaaagctccgagcaacgcgtcccctgctccacttcttac
cacagctctggtttgcactcaagtgacggcgtcacaaaagcaggacccttgggccttccg
gaaataagacaagtgccaactgttgtgattgaatgtgacgacaataaggaaaatgtgcct
catgaacccgactatgaagactcgtcctgcctgtatgcacgggaagaggaggaagaggag
gaggacgaagatgacgacgcctccttgtacaccagctcactggccatgaaggtctgcagg
aaggactccttagccatcaaactgagcaacaggccctccaagcgagagctagaggaaaag
aacatccttcccaggcagacggatgaggaacggctggaactcagacaacagatcggcacc
aagctcaccaggcggctaagccaaagacccactgcagaggaactggagcagaggaacatt
ctgaaacctcggaatgaacaagaggagcaggaggagaagcgggaaataaagaggaggctg
actcgcaagctcagccaaagacccacggtggaagaactccgggagaggaagatccttatt
cgtttcagtgactatgtggaggtggcagacgcccaagactatgaccgaagggcggacaag
ccatggacccgcctcaccgctgcagacaaagctgccattcggaaggaactcaatgagttt
aaaagtaccgaaatggaagtccacgagttaagtagacacttaaccaggtttcatcgacct
taa

DBGET integrated database retrieval system