KEGG   Rattus norvegicus (rat): 306860
Entry
306860            CDS       T01003                                 

Gene name
Gcnt2, Ignt
Definition
(RefSeq) glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
  KO
K00742  N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.150]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    306860 (Gcnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    306860 (Gcnt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.150  N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase
     306860 (Gcnt2)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  I antigen
   306860 (Gcnt2)
SSDB
Motif
Pfam: Branch
Other DBs
NCBI-GeneID: 306860
NCBI-ProteinID: NP_001001511
RGD: 1303198
Ensembl: ENSRNOG00000023778
UniProt: Q6T5D9
Position
17p13
AA seq 400 aa
MNLCMKFFAFTALSVVIFVVFYHSQLSLPNLYQRFNSSSERTSVIACDYGLQNHSVFVPG
ITSPHPLEKLSCSQYQILSHYITSPLSEEEADFPLAYVMVIYKDFDTFERLFRAIYMPQN
VYCVHVDSKAAETFKEAVRHLLSCFPNAFLASRMERVVYGGFSRLQADLNCMRDLVASKV
PWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNLTPGVLPPEHVITRTKYVYKERKGRDGY
FMQNTNTLKTPPPHKLVIYFGTAYVALTRDFVNFILNDKRAIDLLEWSKDTYSPDEHFWV
TLNRIPGVPGAMPNASWTGNLRAVKWKDMESQNGACHGHYVHDICIYGNGDLQWLINSQS
LFANKFEVNTYPLTVECLELRLRERTLNQSDIALQPSWHF
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaacctatgtatgaaatttttcgctttcactgcgctcagcgtggtgatttttgtggtt
ttttatcacagccagctaagcctgcccaacctctaccagcggttcaatagctccagcgaa
aggacgtctgtcatcgcctgtgattacggcttgcaaaatcattcggtcttcgtgccgggg
atcacatcaccacatcctttagaaaaactctcctgctctcagtaccagatcctgagccac
tatattaccagtcccttgtccgaagaagaagctgactttcccttggcctacgtcatggtg
atctacaaagacttcgacacctttgaaaggctcttcagggccatttacatgccccagaac
gtctactgtgtgcacgtggacagtaaggcggcagagaccttcaaagaagcggtgaggcat
ttactgagctgtttccccaatgccttcctggcttctaggatggagcgggtggtctatggt
ggcttctcccggctccaggctgacctgaactgcatgagagatctggtggcttccaaagtc
ccctggaaatatgtcatcaacacctgcgggcaggacttccctctgaaaaccaacaaagaa
atagttcagtacctgaaagggtttaaggggaaaaacctcactccgggggtgctccctcct
gagcatgtaattactcggactaaatacgtatacaaggaacgtaaaggcagagacggatat
tttatgcaaaacacaaatactttgaagactccgcctcctcacaaactggtcatctacttt
ggaaccgcctacgtggccctcacccgagactttgtcaactttatcctgaatgacaaaagg
gccattgatctcttagagtggtctaaagatacctatagcccggatgaacatttttgggtg
acactcaataggattccaggagtccctggcgccatgcccaatgcatcctggacaggtaac
ctcagagctgtgaagtggaaggatatggaatcgcagaatggagcctgccacggtcactac
gtacatgacatttgcatctatggaaacggagacttgcaatggctgattaattcgcagagc
ctgtttgctaacaagtttgaagtcaacacataccctctcactgtggaatgcttggaactg
aggcttcgagaaagaacgctcaatcagagtgacattgccttacagcccagctggcatttc
tga

DBGET integrated database retrieval system